SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015561 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015561
Domain Number 1 Region: 510-675
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.14e-71
Family A middle domain of Talin 1 0.0000000351
Further Details:      
 
Domain Number 2 Region: 775-910
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.82e-53
Family I/LWEQ domain 0.000000256
Further Details:      
 
Domain Number 3 Region: 2316-2507
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.69e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 680-804
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.36e-48
Family I/LWEQ domain 0.000000535
Further Details:      
 
Domain Number 5 Region: 1862-1994
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.35e-46
Family VBS domain 0.000000481
Further Details:      
 
Domain Number 6 Region: 1246-1382
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.33e-38
Family VBS domain 0.013
Further Details:      
 
Domain Number 7 Region: 217-330
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-33
Family Second domain of FERM 0.000000588
Further Details:      
 
Domain Number 8 Region: 1096-1228
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.51e-27
Family VBS domain 0.032
Further Details:      
 
Domain Number 9 Region: 331-421
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-25
Family Third domain of FERM 0.00000848
Further Details:      
 
Domain Number 10 Region: 1432-1576
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000183
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 11 Region: 101-158
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000185
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 12 Region: 2031-2153
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000675
Family VBS domain 0.027
Further Details:      
 
Domain Number 13 Region: 1716-1835
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000091
Family VBS domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000015561
Domain Number - Region: 1619-1679
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00926
Family VBS domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015561   Gene: ENSECAG00000016464   Transcript: ENSECAT00000019033
Sequence length 2562
Comment pep:known_by_projection chromosome:EquCab2:25:931320:961431:-1 gene:ENSECAG00000016464 transcript:ENSECAT00000019033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGGAQSRAAQVSPGWRGEAATMVALSLKISIGNVVKTMQFEPSTMVYDACRIIRECIPE
ALTGPPSDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVK
TIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEEVTGTLRKDKTLLRDEKKM
EKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQ
ARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERK
IFQAHKNCGQISEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVM
RVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDI
ILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGAS
GPENFQVGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDT
LPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVT
TISSNLTEMSRGVKLLAALLEDEGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLL
QAAGNVGQASGELLQQIGESDTDPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGL
QTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAAT
EDEQLLRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGD
AGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAA
AHPDSEEQQQRLREAAEGLRMATNAAAQNAIKKKLVQRLEHAARQAAASATQTIAAAQHA
ASTPKASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPKGGWYFICLPVSLQPGGK
MVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQN
LERDLQEVKAAARDGKLKPLPGETMEKCAQDLGNSTKAVSSAMAQLLGEVAQGNENYAGI
AARDVAGGLRSLAQAARGVAALTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDP
ESQQRLAQVAKAVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQ
SRLNEAAAGLNQAATELVQASRGSPQDLARASGRFGQDFNTFLEAGVEMAGQAPSQEDRA
QVVSNLKGISMSSSKLLLAAKALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPG
QKECDNALRELETVRELLENPVQPVNDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNL
PEFGEAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQ
SLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANL
VKTIKALDGAFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPI
VISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQL
ECETAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASA
AQAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTA
KEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLD
EGPMGEPESSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQ
AKPAAVAAENEEIGAHIKHRVQELGHGCAALVTKAGALQCSPSDTYTKKELIECARRVSE
KVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGI
LKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVV
LINAVKDVAKALGDLISATKAAAGKAGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEA
TKGTRALEATTEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQE
DVIATANLSRRAIADMLRACKEAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQ
KPSPELKQQLTGHSKRVAGSVTELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAA
AKKLEQLKPRAKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAI
PANALDDGQWSQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLL
VACKVKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFEDQENETVVVKEKMVGGIA
QIIAAQEEMLRKERELEEARKKLAQIRQQQYKFLPSELRDEH
Download sequence
Identical sequences F6PN89
ENSECAP00000015561 ENSECAP00000015561 9796.ENSECAP00000015561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]