SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015986 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015986
Domain Number 1 Region: 417-470
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000122
Family RING finger domain, C3HC4 0.0091
Further Details:      
 
Domain Number 2 Region: 338-403
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000442
Family IBR domain 0.019
Further Details:      
 
Domain Number 3 Region: 43-122
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000337
Family Ubiquitin-related 0.014
Further Details:      
 
Domain Number 4 Region: 263-341
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000106
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015986   Gene: ENSECAG00000018193   Transcript: ENSECAT00000019525
Sequence length 495
Comment pep:known_by_projection chromosome:EquCab2:22:21946081:21962035:-1 gene:ENSECAG00000018193 transcript:ENSECAT00000019525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEEMALRLARAVAGGDEQVAMQCATWLAEERVPLIVQLKPEVSPTQDIRLWVSVEDAQMH
VDTIWLTVRADMTVASLKDMVFLDYGFPPTLQQWVIGQRLARDQETLHSHGVRRSGDSAY
LYLLSARNTSLNPQKLQRERKLRMLRCVGLEGRHLRIAAPLPLLPATHDHTTGGDLVLDC
DPLCPGGHPVAETLLPGCDHICGPDHIPICHPSSAFPRLRPPPSWSDPPRGPAPCAQRKQ
QQQEGNYLQHVQLDQRSLVLNTEPTECPVCYSVLAPGEAVVLRECLHTFCRECLQGTILN
SQEAEVACPFIDNTYSCSGKLLEREIRALLSPEDYQRFLDLGVSIAENRSAFSYHCKTPD
CKGWCFFEDDVNEFECPVCKQVNCLLCKAIHKDMNCKEYQDDLALRAQDDVAARQTTEML
RLMLQQGEAMHCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPRGPGDTSGGCRC
RVNGVPCHPSCQNCH
Download sequence
Identical sequences F7DKI3
9796.ENSECAP00000015986 ENSECAP00000015986 ENSECAP00000015986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]