SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016574 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016574
Domain Number 1 Region: 45-286
Classification Level Classification E-value
Superfamily RNI-like 9.42e-28
Family Cyclin A/CDK2-associated p19, Skp2 0.083
Further Details:      
 
Domain Number 2 Region: 379-467
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.85e-22
Family Ubiquitin-related 0.0000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016574   Gene: ENSECAG00000018794   Transcript: ENSECAT00000020205
Sequence length 467
Comment pep:known_by_projection chromosome:EquCab2:1:75908982:75930813:-1 gene:ENSECAG00000018794 transcript:ENSECAT00000020205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHPTGGSFIRPNKVNFGVDFLTALKNRYVLEDGPEEDGKEQIVTIGNRTVQTVGFDSVIK
RQSQLNKLEDISLRNCAVNGAGDKGGIARACPHIRKVDLSRNLLSSWDDVIDIADQLKDL
EVLNLSENKLEFPSCSTSLIGTFSALKVLVLNRTGITWAEVLRCAPGWPVLEELYLGSNN
ICISERPVDVLQTVKLLDLSSNQLIDENQLFLIAYLPRLEQLILSNIGISSIHFPDAGIG
CKTSLFPSLQYLVVNDNQISQWSFINELDKLQSLDTLSCVRNPLTAGSKDSQTTRQFIIA
RIGQLKTLDRCQILPEERRGAELDYRKAFGNEWKKAGGHQNPDKNRPNEEFLAAHPRYQF
LCQKYGAPEDGELKTQQPFILKNQLLTLKIRYPDQLDQKVLEKQLPDSMTIQKVKGLLSR
LLKVPVSQLLLSYESPKMPGREIELENDQQSLQFYSVENGDSLLVRW
Download sequence
Identical sequences F6Z7N9
ENSECAP00000016574 ENSECAP00000016574 9796.ENSECAP00000016574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]