SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016897 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016897
Domain Number 1 Region: 125-305
Classification Level Classification E-value
Superfamily HAD-like 4.91e-30
Family NLI interacting factor-like phosphatase 0.081
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-20
Family Ubiquitin-related 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016897   Gene: ENSECAG00000019228   Transcript: ENSECAT00000020573
Sequence length 318
Comment pep:known_by_projection chromosome:EquCab2:14:20227686:20247078:-1 gene:ENSECAG00000019228 transcript:ENSECAT00000020573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVK
LGALKLKPNTKIMMMGTREESLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISR
RVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIV
IWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFS
EFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELLKLTQYLKEIAKLDDF
LDLNHKYWERYLSKKQGQ
Download sequence
Identical sequences A0A096N829 A0A0D9RDL2 A0A287BNL3 A0A2J8X6T4 A0A2K5BZE4 A0A2K5JBF2 A0A2K5LVP3 A0A2K5Q582 A0A2K5YT48 A0A2K6BGY7 A0A2K6P4N8 A0A2K6SU96 E2RR79 F6VI02 F7BKH3 F7HWY6 G1LIW6 G1QW59 G3RF15 G7P6S1 H2QRX2 L8IFX6 M3WRA7 M3YPN9 Q2KJD7 Q8WVY7 W5PU58
ENSBTAP00000011999 ENSBTAP00000011999 GO.40823 HR5613 ENSGGOP00000014169 ENSMMUP00000028573 ENSMMUP00000033782 ENSPTRP00000029867 ENSCAFP00000025471 ENSP00000296786 ENSOARP00000013989 ENSFCAP00000016890 ENSAMEP00000006870 ENSSSCP00000018055 gi|193083197|ref|NP_659486.2| ENSSSCP00000018055 ENSMPUP00000013297 ENSCAFP00000025471 ENSP00000296786 9544.ENSMMUP00000033782 9598.ENSPTRP00000029867 9606.ENSP00000296786 9615.ENSCAFP00000025471 9796.ENSECAP00000016897 9823.ENSSSCP00000018055 9913.ENSBTAP00000011999 ENSNLEP00000005180 ENSPANP00000008747 ENSMPUP00000013297 ENSCJAP00000035389 ENSGGOP00000014169 ENSMMUP00000028573 ENSECAP00000016897 ENSCJAP00000035389 ENSPTRP00000029867 NP_001039459.1.59421 NP_001039459.1.76553 NP_001253320.1.72884 NP_659486.2.87134 NP_659486.2.92137 XP_001503537.1.31192 XP_002744153.1.60252 XP_002912554.1.58354 XP_003134148.1.46622 XP_003268646.1.23891 XP_003819048.1.60992 XP_003934807.1.74449 XP_003981363.1.62641 XP_004009079.1.66739 XP_004042968.1.27298 XP_004404841.1.74151 XP_004428635.1.5094 XP_004737767.1.14098 XP_005558469.1.63531 XP_005683294.1.57651 XP_005897576.1.15283 XP_005977534.1.78601 XP_006067060.1.26621 XP_006178030.1.101512 XP_006211960.1.17985 XP_006906533.1.64745 XP_007077661.1.5354 XP_008013364.1.81039 XP_008145886.1.99482 XP_008513387.1.77740 XP_008585896.1.73410 XP_008585897.1.73410 XP_008690659.1.72690 XP_010370296.1.97406 XP_010805865.1.76553 XP_010853604.1.44457 XP_010948614.1.22495 XP_010991109.1.51371 XP_011740682.1.29376 XP_011803082.1.43180 XP_011822074.1.47321 XP_011906258.1.92194 XP_012000885.2.54773 XP_012316473.1.9421 XP_014698214.1.49734 XP_014919367.1.86478 XP_016022546.1.101085 XP_016069487.1.3490 XP_017357591.1.71028 XP_017357592.1.71028 XP_017741217.1.44346 XP_017741218.1.44346 XP_017822710.1.60252 XP_019289301.1.44245 XP_019596123.1.88060 XP_019820895.1.53367 XP_020758966.1.74333 XP_021553542.1.83697 XP_527100.2.37143 XP_546271.2.84170 ENSNLEP00000005180 ENSECAP00000016897 ENSAMEP00000006870 ENSP00000296786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]