SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018218 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018218
Domain Number 1 Region: 1699-1999
Classification Level Classification E-value
Superfamily BEACH domain 1.18e-125
Family BEACH domain 0.00000000891
Further Details:      
 
Domain Number 2 Region: 2120-2373
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.44e-29
Family WD40-repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 1575-1662
Classification Level Classification E-value
Superfamily PH domain-like 5.1e-24
Family PreBEACH PH-like domain 0.004
Further Details:      
 
Domain Number 4 Region: 267-417
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000924
Family Laminin G-like module 0.059
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000018218
Domain Number - Region: 18-34,68-239,627-698,800-863
Classification Level Classification E-value
Superfamily ARM repeat 0.038
Family Armadillo repeat 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018218   Gene: ENSECAG00000020049   Transcript: ENSECAT00000022068
Sequence length 2409
Comment pep:known_by_projection chromosome:EquCab2:18:77834917:77930121:1 gene:ENSECAG00000020049 transcript:ENSECAT00000022068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDTITAMLDCTDRPVLQAIFLNSNCFEHLIRLLQNCKLYISGQSPYKNEKDLANKLLTEM
NEDQVFQGQLDCLAVSTIQALTAVMNKSPAAKEVFKERIGYTHMFEVLKSLGQPAVELLK
ELMNMAVEGDHTSVGILGISNVQPLLLLIQWLPELESHDLQIFISDWLKRICCINRQSRT
TCVNANMGIRIIETLDSHSSLHRTCAENLIALHGSLGSQSVSSEEIRRLLRLLRVDESEC
VHPYATPVTRAILTMARKQSLESALQYFNLSHSMAGITVPSIQKWPGSAFSFNAWFCLDQ
DQLTPGSANKGGKRKQLYSFFTGSGMGFEAFITHSGTLVVAVCTKREYATVMLPDHSFCD
SLWHNITIVHMPGKRPFGQSVVFIYDNGQQKVSAPLRFPAMNEAFVSCCIGSAGQRTTTP
PPSQIPDPPFSSPITPHRTSFGGILSSASWGGTIEKSKLITKLISAGTQDSEWGCPTSLE
GQLGSVIIFCEALQPPQVKALYLAGPNCLSPWKFQESDMADLPGNVLLHYTAKACKNSIC
LDLSANCLHGRLTGNKVVNWDIKDIINCIGGLNVLFPLLEQISHSSEGQIAEGMNESTVS
ELITPVEGDWVVLTSTKASESRLERNLIATFILIVKHFIQRHPINQDNLIHSHGVATLGA
LLQKVPSTLMDVNVLMAIQLLIEQVSLEKNMQLLQQMYQYLLFDFRIWNRGDFPFRIGHI
QYLSTIIKDSRRVFRKKYGVQFLLDTLRIYYGDCKYSELSLDDIRTIRTSLYGLIKYFLC
KGGTHEEIQSIMGYIAAISEEEQLFGILDILFSLLRTSPTRGQLFLLLFEPGNADILYAL
LLNQKYSDRLREVIFKVMEQMLKCTNVYERSKQRIRLREVGYSGLGLLLSEAPVNTSLLK
NLTNQIVNADPAINFKDLLSVVYMSRRAHINVRVVICRKILQILQSQPDAAHQISQQVGW
QDTLVRLFLKANFENGNTLHKHRTSMKRWMRKKSTLLPPLISVGELSFKSENQEEFWHHS
PSHLSLDLSRIDSCELSDSGGQMPDSLPSTPSPIESTKSFSVPSDKESSITKVTKLCVLR
AKPVFSSSLFSVCDGSYDRCEEELLQLLTNILSYVMCKGLEKSDDDAWIERGQVFAALTK
PGISSELLRPSDEIKLILLQKMLEWTVTENREAKTNPVTAENAFRLMLIVQDFLQSEGLV
NPNVWTEKLLENMMQLFDGLSVWYSESPVWVKLSQIQIQLLLGFIGRGNLQDSHMAYVRR
HCSLRASPFISRDRECFFLQSLLAGSSSGISFPSALGCTPVTQPLCARAPSSPTETYSFL
IPLVRTLVSKIYELLFMNLHLPSLPFTNGSSSFFEDFQEYCSSNEWQVYIEKYIVPYMKQ
YETHTFYDGHENMALYWKDCYEALMVNMHKRDREGGESKLKFQEFFVEPFNRKARQENLR
YNNMLKQLSSQQLAALRRWKAVQLYLTCERGPWAERKQNPIHWKLANVENYSRMRLKLVP
NYNFKTHEEASALRDNLGEFLLTMSLSSRLLIPTQNSSLGTIPALLQNSQELGRDIIAIL
EMSPVDEKEEQDQKEKLVLSEDCELITMIDVVPGRLEITTQHIYFYDGSIEKEDGEERVG
FDFKWPHSQVREIHLRRYNLRRSALEIFHVDQSNYFLNFKKEVCGSEITTGAGLPGTSPA
PSPPSLVRNKVYSRLLSLHSPNSYGTRSPQELFKASGLTQKWVNREISNFDYLIQINTMA
GRTYNDLAQYPVFPWILQDYTSEELDLNNPSVFRDLSKPIGVINDKNAKAMREKYENFED
PMGTIDKFHYGTHYSNSAGVMHYLIRTEPFTTLHIQLQSGRFDCADRQFHSIPATWQALM
DNPYDVKELIPEFFYFPEFLENQNEFNLGHLQVSKELVNDVILPKWAKSAEDFIYKHRKA
LESEYVSAHLHEWIDLIFGYKQRGPAAVEALNVFYYCSYEGAVDLDALTDEKERKALEGM
INNFGQTPCQLLKEPHPPRLSAEEAVQKQTKMDTPSLNLFQHLPELKSFFIEGISDGIPL
IKAIVPKNQSRSFMSQGSPELLITVSMNYVIGTHGWLPYDRSISNYFTFIRDPTVTNPKT
QRSMNGPFAPGLEITSKLFIVSHDAKLLFSAGHWDNSIQVMSLTKGKVISHNIRHMDIVT
CLATDYCGIHLISGSRDTTCMIWQITQQGGVPVGLASKPFQILYGHTDEVLSVGISTELD
MAVSGSRDGTVIIHTIQKGQYMRTLRPPCESSLLLTVPSLAISWEGHVVIYSSIEEKTTL
KDKNALHVFSVNGKYLRSQVLKEQVSDMCVIGEHVITGSLQGFLSIRDLHSLNLSINPLA
MRLPIHCVCVTKEHSHILVGLEDGKLIVVGVGKPAEMRSGQLTRKLWGSSKRLSQISAGE
TEYNTQDPK
Download sequence
Identical sequences F6TD65
ENSECAP00000018218 ENSECAP00000018218 9796.ENSECAP00000018218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]