SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019126 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019126
Domain Number 1 Region: 930-1035
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-29
Family PDZ domain 0.00082
Further Details:      
 
Domain Number 2 Region: 538-646
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-26
Family Third domain of FERM 0.0046
Further Details:      
 
Domain Number 3 Region: 753-856
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-23
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 432-537
Classification Level Classification E-value
Superfamily Second domain of FERM 1.3e-22
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 5 Region: 1061-1166
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-20
Family PDZ domain 0.037
Further Details:      
 
Domain Number 6 Region: 338-427
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000117
Family First domain of FERM 0.019
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019126
Domain Number - Region: 77-171
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00597
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019126   Gene: ENSECAG00000021638   Transcript: ENSECAT00000023105
Sequence length 1306
Comment pep:novel chromosome:EquCab2:1:82385119:82463695:1 gene:ENSECAG00000021638 transcript:ENSECAT00000023105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGMSPTSVTLASALQVRGEALSEEEIWALLSLAAERLLEDLRDDSSDYVVCPWSTLLSEA
GSLSFQDHSSHGEAAPFKAPELLQGQSDEERPDASRMHVYSLGMTLYWSAGFHVPPDQPL
QLREPLHSLLLTMCEDQPSRRLPLPAVLEACRLHQDDAAIYPASANLHVRRLVSVVLGSG
SEVGRKAVEESSSVQQDRSCQLRNRLHQASCEGSVAPASDGLHPSKVSERSTETQSSLEP
GLSASAHSRGSISVNSTLPAEAPQNLQEGWRLSSGSAPSVAAENSQPATPSQRAFVQRKG
KFSRPEFVLLAREAPVTLHLPGSIVTKKGKSYLALRDLCVVLLSGQSLEVKCDVTSTAGA
IFNAVVSFANLGELAYFGLAYMKGKEFFFLDPETRLCKIAPEGWSEQPRKKTSSDAFTLF
LRIKFFAGHCGLLQQSRTRHQFYLQLRKDILEEKLHCNDEMLLQLGVLALQAEFGNYPEE
QGESKAYFRVEDYVPASLIERMTAFRVQVEVSEMHRLSPMLWGEDAELEFLRVTQQLPEY
GVLVHRVLPEKTRPEGETALGICAKGVIVYEVKNNSRITTLRFQWREIWKISTCRKKFTI
TSSITGKKHTFVTDSGKTCKYLLGLCSAQHGFNAKMSSPRQLSSILYNHDKHVQMANLSL
AHLAQPKPLSWIQRLSRSENTLFTPRLEDATGGLLRASLDDFTVETSKETGVRGIGASPC
TGRERLESICLIQKPTTCDPLSGPSVQSTCTGPQNNRRKSFPAEPDGEIVHVTLTRDPRR
GFGFVINEGEDADEVDPGIFISSIIPGGPAEKAKKIKPGGQILALNRISLEGFTFDMVVR
MIQNSPDNIELIISQSKGVCGNTPSKEKNSTARSGGFSTDSLTNGHQGGCSSRTPDQERN
TEELETALAQSSMPGRSPQLSPLPLKGAGSSCPPSPSETNASEIYFVELIKEDGTLGFSV
TGGVNTSVLYGGIYVKSIVPGGPAAKEGQILRGDRLLQVDGVSLCGLTHRQAVQRLKGSG
QVVRLVLERRGPRTAQQCPSASDRMGDDCTAVSLATALPGRPASCVLATDGPTFEVTLRK
NASGLGFSFTQMERARCSHLKNDLVRINRLFPGQPAEENGAIAAGDIILAVNGRPTEGLV
FQEVLHLLRGPSKEVTLLLCRPPPGALPEMDQGWQIPVLSADKEFTRAAGSDSEQSPSLD
QEDSQRDSASLDTGEGLGLKPESFQKATREAQWDQDVERPLATSLPRRPQDSHPHLCRLH
QELDAAALPTSLEKDVRQNCYSVCDIRKLESFSCSSSLTRLSTDIF
Download sequence
Identical sequences F6WKY3
ENSECAP00000019126 9796.ENSECAP00000019126 ENSECAP00000019126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]