SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019420 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019420
Domain Number 1 Region: 491-656
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.44e-69
Family A middle domain of Talin 1 0.00000032
Further Details:      
 
Domain Number 2 Region: 756-891
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.94e-53
Family I/LWEQ domain 0.00000202
Further Details:      
 
Domain Number 3 Region: 661-785
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.1e-52
Family I/LWEQ domain 0.00000457
Further Details:      
 
Domain Number 4 Region: 2309-2499
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.08e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 5 Region: 1853-1987
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.57e-47
Family VBS domain 0.00000732
Further Details:      
 
Domain Number 6 Region: 1239-1375
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.8e-41
Family VBS domain 0.028
Further Details:      
 
Domain Number 7 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 8.37e-32
Family Second domain of FERM 0.0000013
Further Details:      
 
Domain Number 8 Region: 1088-1221
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.81e-29
Family VBS domain 0.012
Further Details:      
 
Domain Number 9 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 8.88e-25
Family Third domain of FERM 0.0000172
Further Details:      
 
Domain Number 10 Region: 1483-1569
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000000955
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 11 Region: 2019-2146
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000298
Family VBS domain 0.015
Further Details:      
 
Domain Number 12 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000737
Family Ubiquitin-related 0.062
Further Details:      
 
Domain Number 13 Region: 1710-1828
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000011
Family VBS domain 0.061
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019420
Domain Number - Region: 1599-1673
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000345
Family VBS domain 0.041
Further Details:      
 
Domain Number - Region: 2121-2242
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00981
Family I/LWEQ domain 0.0047
Further Details:      
 
Domain Number - Region: 924-985
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0667
Family I/LWEQ domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019420   Gene: ENSECAG00000020488   Transcript: ENSECAT00000023447
Sequence length 2555
Comment pep:known_by_projection chromosome:EquCab2:1:129230635:129422024:-1 gene:ENSECAG00000020488 transcript:ENSECAT00000023447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKVEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMV
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVNLLAAL
MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATDDSELLKQVSAAASVVSQA
LHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKA
VADHIPQLVQGVRGSQAQTEDLSAQLALIISSQNFLQDPPSYLPFISLQPGSKMVSSAKA
AVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKATETCGPMEIDSALSTVQTLKNELQD
AKMAAVESQLKPLPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQ
ALKTLAQAARGVAASTSDPAAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAESQQRLA
QVAKAVSHSLNNCVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAA
ADLNQSAGEVVHATRGQTGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLK
NISMASSKLLLAAKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNA
LRELETVKGMLDNPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECV
GIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGS
SPSQVLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKAL
DGDFSEENRNKCRIATAPLIEAVENLTAFASNPEFVSVPAQISSEGSQAQEPILVSAKTM
LESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSID
GINRCIRDIEQASLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQ
LGHKVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNP
KQAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEP
KGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLALQGQMAAAT
AEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLS
ALQAGNKGTQACITAATAVSGIIADLDTTIMFATAGTLNAENNETFADHRENILKTAKAL
VEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKD
VAKALSDLIGATKGAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRAL
EATIEYMKQELTVFQSKEIPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATAN
LSRKAVADMLTACKQASFHPDVSEEVRTRALRYGTECTLGYLDLLEHVLVILQKPTPELK
HQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQL
KPRAKPKQADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADD
GQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKA
DQDSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEE
MLKKERELEEARKKLAQIRQQQYKFLPTELREDEG
Download sequence
Identical sequences F6YKI1
ENSECAP00000019420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]