SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020475 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020475
Domain Number 1 Region: 133-226
Classification Level Classification E-value
Superfamily TAFH domain-like 3.53e-36
Family TAFH domain-like 0.00000269
Further Details:      
 
Domain Number 2 Region: 419-466
Classification Level Classification E-value
Superfamily Histone-fold 6.7e-17
Family TBP-associated factors, TAFs 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020475   Gene: ENSECAG00000023048   Transcript: ENSECAT00000024638
Sequence length 632
Comment pep:known_by_projection chromosome:EquCab2:22:47598302:48005939:-1 gene:ENSECAG00000023048 transcript:ENSECAT00000024638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLVRSENGQLLMIPQQALAQMQAQAHAQAQPQTTMAPRPATPTSAPPVQISTVQAPGTP
IIARQVTPTTIIKQVSQAQTTVQPTTALQRSPGVQPQLVLGGAAQTASLGTATAVQTGTP
QRTVPGATTTSTAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKI
EAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPASQATTAL
TAVVLSSSVQRTAGKTAATVTSALQPPVISLTQPTQVGVGKQGQPTPLVIQQPPKPGALI
RPPQVTLTQTPMVALRQPHNRIVLTTPQQIQLNQLQPVPVVKPAVLPGTKALSTVSAQAA
AAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFL
LPAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQSLVEKISETAQQKNFSYKDDDR
YEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQ
QELAQMRQRDANLTALAAIGPRKKRKVDSPGPGSGTEGAGPGSAVPGSSGVGTPRQFTRQ
RITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences F6UFM6
ENSECAP00000020475 ENSECAP00000020475 9796.ENSECAP00000020475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]