SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020687 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020687
Domain Number 1 Region: 205-450
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.82e-87
Family Eukaryotic proteases 0.0000958
Further Details:      
 
Domain Number 2 Region: 109-212
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-18
Family Hepsin, N-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020687   Gene: ENSECAG00000023128   Transcript: ENSECAT00000024880
Sequence length 457
Comment pep:known_by_projection chromosome:EquCab2:7:22098353:22108612:-1 gene:ENSECAG00000023128 transcript:ENSECAT00000024880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDGQAPMEAQYAEEGPGPGIFRSTEQGEAGRYISPSRRWCSRRRGCAVLGALGLLAGAS
VGSWLLVLYLWPAASQPVPRNSQDEEMTLNCSEASGGEEALLPSIPKAVSFRINKEDFLL
QVQVRARPDWLLVCHEGWSSALGVRICRSLGHLRLTHHKGVNLSDLKLNSSQEFAQLPPR
LGGLLEEVWQPRDNCTSGQIVSLKCSECGARPLASRIVGGQAVAPGRWPWHASVALGSRH
TCGGSVLAPHWVVTAAHCMHFRLSRLSSWRVRVGLVSHSMVRTHQGAVVERIIPHPLYSA
QNHDYDVALLRLRTPLDFSDTVGAVCLPAEEQDFPRGSQCWVSGWGHTDPSHAHSSDTLQ
DMVVPLLSTQLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCQDGGTWRLVGV
VSWGHGCAEPNHPGVYAKVAELLDWIQDTAQDSLSEA
Download sequence
Identical sequences F6V200
9796.ENSECAP00000020687 ENSECAP00000020687 ENSECAP00000020687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]