SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020692 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020692
Domain Number 1 Region: 201-446
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.82e-87
Family Eukaryotic proteases 0.0000958
Further Details:      
 
Domain Number 2 Region: 105-208
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-18
Family Hepsin, N-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020692   Gene: ENSECAG00000023128   Transcript: ENSECAT00000024886
Sequence length 453
Comment pep:known_by_projection chromosome:EquCab2:7:22098353:22108612:-1 gene:ENSECAG00000023128 transcript:ENSECAT00000024886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDGQAPMEAQYAEEGPGPGIFRSAQQQPISPSRRWCSRRRGCAVLGALGLLAGASVGSW
LLVLYLWPAASQPVPRNSQDEEMTLNCSEASGGEEALLPSIPKAVSFRINKEDFLLQVQV
RARPDWLLVCHEGWSSALGVRICRSLGHLRLTHHKGVNLSDLKLNSSQEFAQLPPRLGGL
LEEVWQPRDNCTSGQIVSLKCSECGARPLASRIVGGQAVAPGRWPWHASVALGSRHTCGG
SVLAPHWVVTAAHCMHFRLSRLSSWRVRVGLVSHSMVRTHQGAVVERIIPHPLYSAQNHD
YDVALLRLRTPLDFSDTVGAVCLPAEEQDFPRGSQCWVSGWGHTDPSHAHSSDTLQDMVV
PLLSTQLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCQDGGTWRLVGVVSWG
HGCAEPNHPGVYAKVAELLDWIQDTAQDSLSEA
Download sequence
Identical sequences F6V1M0
ENSECAP00000020692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]