SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50120134|ref|YP_049301.1| from Pectobacterium atrosepticum SCRI1043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50120134|ref|YP_049301.1|
Domain Number 1 Region: 91-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000157
Family NfeD domain-like 0.0057
Further Details:      
 
Weak hits

Sequence:  gi|50120134|ref|YP_049301.1|
Domain Number - Region: 28-82
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000798
Family LacY-like proton/sugar symporter 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50120134|ref|YP_049301.1|
Sequence length 151
Comment hypothetical protein ECA1195 [Pectobacterium atrosepticum SCRI1043]
Sequence
MGIELVMENAHWFWLSLGGLLLAAEMLGGSGYLLWSGLSAVLVGLLTWIMPLGWPWQGTI
FAILTIVTALLWWYWLRKRTLSRPPSTLNQRGQQLVGLRATVSESVTNGFGRVNIGDSSW
RVKSEQDLPAGTHVEVIAVDGITLHVRSIER
Download sequence
Identical sequences Q6D7Y0
gi|50120134|ref|YP_049301.1| 218491.ECA1195 GO.2760 WP_011092786.1.17763 WP_011092786.1.32123 WP_011092786.1.57850 WP_011092786.1.77917 WP_011092786.1.79946 WP_011092786.1.80346 WP_011092786.1.94180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]