SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MLOC_37911.4 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_37911.4
Domain Number 1 Region: 5-51
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0000000879
Family 2Fe-2S ferredoxin-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MLOC_37911.4
Sequence length 71
Comment pep:novel chromosome:030312v2:4:11989930:11990837:1 gene:MLOC_37911 transcript:MLOC_37911.4 description:"Uncharacterized protein "
Sequence
APAGAVPTHKVTVHDRERGVVHQFVVPQDQYILHTAEAQDITLPFACRHGMLGVSRPRRI
ILMFANHHLTN
Download sequence
Identical sequences MLOC_37911.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]