SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MLOC_45867.1 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_45867.1
Domain Number 1 Region: 6-83
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000726
Family B3 DNA binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MLOC_45867.1
Sequence length 215
Comment pep:novel chromosome:030312v2:6HL:33617967:33618971:-1 gene:MLOC_45867 transcript:MLOC_45867.1 description:"Uncharacterized protein "
Sequence
NVFPQIIQKEFVHRFKGEIPGEIELQTKNKCTYKIKVVKNQEGQLVLAAGWGRFIEKFSL
QTRDSIILFSYNGKSQFSVIILDQLGREKASSVVNPFPPRALERHTNCAETVSQHPSDGH
PLPVERLVQSTDAAANILHRPTQIPETADCSLPLMIMPSTAHFDVHHQQQAMLMQPPLNH
SSSSEASAGEGDGSFSSHDHVQNALGFVRVVRRKY
Download sequence
Identical sequences MLOC_45867.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]