SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MLOC_55345.13 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_55345.13
Domain Number 1 Region: 139-206
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-28
Family B3 DNA binding domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MLOC_55345.13
Sequence length 206
Comment pep:novel chromosome:030312v2:2:588254673:588255730:-1 gene:MLOC_55345 transcript:MLOC_55345.13 description:"Uncharacterized protein "
Sequence
MAASQSQEKQHLPAFGVLRNAAALLDEMQLMGEAQGAKKVINSELWHACAGPLVCLPQRG
SLVYYFPQGHSEQVAATTKKTPNSRIPNYPSLPSQLLCQVHNITMHADKDTDEVYAQMTL
QPVNSETDVFPIQSLGSYAKSKHPAEYFCKNLTASDTSTHGGFSVPRRAAEKLFPQLDYS
MQPPNQELIVRDLHDNMWTFRHIYRG
Download sequence
Identical sequences MLOC_55345.13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]