SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MLOC_62464.5 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_62464.5
Domain Number 1 Region: 270-446
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 1.42e-63
Family alpha-Subunit of urease 0.0000146
Further Details:      
 
Domain Number 2 Region: 132-260
Classification Level Classification E-value
Superfamily Urease, beta-subunit 1.19e-49
Family Urease, beta-subunit 0.0000649
Further Details:      
 
Domain Number 3 Region: 1-105
Classification Level Classification E-value
Superfamily Urease, gamma-subunit 4.32e-41
Family Urease, gamma-subunit 0.000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MLOC_62464.5
Sequence length 539
Comment pep:novel chromosome:030312v2:5:535381026:535392141:-1 gene:MLOC_62464 transcript:MLOC_62464.5 description:"Urease "
Sequence
MKLVPREAEKLALHGAGFLAQKRLARGLRLNYTEAIALIASQILEFVRDGDKTVTDLMDL
GKQMLGRRQVLPAVPYLLDTVQVEGTFMDGTKLITVHDPISSDDGNLELALHGSYLPVPS
LEKFSGSDVEDYPGEVHFCSGRIILNLHRRALTLKVVNKADRPIQIGSHYHFIEANPYLV
FDRLRAYGMRLNIPAGTAVRFEPGDAKRVTLVSIGGRKVIRGGNGIADGAVDSSQLNEVI
QKITENCFGHEDYPDASEGLIGDGIFDCSVDHEKYSSMYGPTTGDKIRLGDTDLFAEIEK
DFAVYGDECIFGGGKVLRDGMGQSAGYPASASLDTVITNAVVIDYTGIYKADIGIKDGLI
IAIGKAGNPDVMDGVHSNMIVGVNTEVIAAQGMIVTAGGIDCHVHFICPQLINEAIASGI
TTLVGGGTGPAHGTCATTCTPAPSQMKLMLQSTDEFPINVGFTGKGNTAKPEGLSEIIKA
GAMGLKLHEDWGSTPAAIDNCLSVAEAFDIQVRCLVLSSYHAGIRAYLYSGDAHQNSTG
Download sequence
Identical sequences MLOC_62464.5 MLOC_62464.7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]