SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MLOC_64376.5 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_64376.5
Domain Number 1 Region: 44-151
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000765
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MLOC_64376.5
Sequence length 272
Comment pep:novel chromosome:030312v2:3:541289617:541294693:1 gene:MLOC_64376 transcript:MLOC_64376.5 description:"Uncharacterized protein "
Sequence
MSNPCDSDGSQKERSFSSDEASVQCYLTKAQKVKIAAIIEKIQSKITVLVVQMKKSNVKR
HANLVIRKDYALEHFPREYTIVILQLPGKNKDWKGTFRIRPSGMSDAGRCNLYLGNFARD
NHVREGDICLFQPMTNVKQRRFLVKVHILHKVSIDGTTQSSARKRPDSDGCLKEDSSHNY
KSANTPAVSYTSKEFSEENPAADEVMELDDLQTLSKDYVLSGKCDLTVAQGAKINALVDK
IRPQIPVLVVQMKKSSSTNGAILTIKKDYAIK
Download sequence
Identical sequences MLOC_64376.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]