SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MLOC_7649.1 from Hordeum vulgare 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MLOC_7649.1
Domain Number 1 Region: 9-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000149
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 153-230
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000373
Family B3 DNA binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MLOC_7649.1
Sequence length 259
Comment pep:known chromosome:030312v2:4HL:6375912:6377612:-1 gene:MLOC_7649 transcript:MLOC_7649.1 description:"Uncharacterized protein "
Sequence
MDVLEVFEFFEIILENSFSSQRLPDKFAKLLDGREPREVKLREAGSGRGSLWDVVVVFDA
DGHMYLERGRKQFVRAHDLRLGHLLVFSYDGDAVLTVKVFDLSMCRRHYQDDTSSGSSSD
SSSDSTSSRSAEMDVDDAPTSQFAVTLSVCHFLGKQQQYLNVPLEFHEAHGYAKRSKVVL
RMRGMDWAVNLKHNKRAGGKTRSTFRYGWHQFLVDNRLKVGDICFFRALRGNNAGRGGDD
GDDHELKVQVRKLDGSFVD
Download sequence
Identical sequences MLOC_7649.1 MLOC_7649.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]