SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29140561|ref|NP_803903.1| from Salmonella enterica subsp. enterica serovar Typhi str. Ty2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29140561|ref|NP_803903.1|
Domain Number 1 Region: 48-356,437-466
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.55e-62
Family Type II chitinase 0.00029
Further Details:      
 
Domain Number 2 Region: 367-435
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000117
Family Chitinase insertion domain 0.0041
Further Details:      
 
Domain Number 3 Region: 643-697
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.000000667
Family Carbohydrate binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29140561|ref|NP_803903.1|
Sequence length 699
Comment chitinase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
Sequence
MATSKLIQGDTITETTHAANGFDPATSDDKISYTSARVAKPVYNKYKNSTTKPKVFGYYT
DWSQYDSRLQGNMSQPGRGCDLTNVSPTAYDKLIFGFVGITGFRKIDKEDRDVVAEAAAL
CGKVKYEPTFLDPWGDFQSYINLGFETSGWDVDPKTVTQANAKGMLGALRDMQAKAKAAG
HTLALSMSIGGWSMSNGFHETAASDSSRKTFAKGVVKLFKQFPMFSEVDIDWEYPNDEGA
GNPFGAEDGANYALLIAELRKQLDSAGLSNVKISIAASAVTTIFDHAKVKDLLAAGLYGI
NLMTYDFFGTPWAETLGHHTNRKALEEGGWAVETIVDHLLAEGFSADRINIGYAGYTRNA
RQVEIESLSPLKGSYNPGSGDTTGSFESGTSEWYDVIYSYLDLENQKGRNGFNVYTDQVA
DADYLYSPESKLFLSLDTPRTVKAKGEYAAKLGLGGVFTWTIDQDNGVLVNAVREGLGYE
IESEVIDMEPFYFEGINVEKDDEQSDSDDAQKVNHAPKAAIELMVVGGSTVQLSGAGSSD
EDNDELSFSWGVPSQIDVADKTAEIIEVVVPEVSEKTAFQFTLFVRDCYNEPSSQQRFVL
TAVPALSQVQPEPEEEEEIIVPVPDEEEETTPAEDDTSADDKTSPYAQWDASTVYGANWG
SFEIVSWKGHNYQVKWWSMGNQPDLNCGVGGAWTDLGAY
Download sequence
Identical sequences Q8Z9Q6
gi|378958150|ref|YP_005215636.1| NP_454628.1.84458 WP_000235792.1.100008 WP_000235792.1.100036 WP_000235792.1.100079 WP_000235792.1.100196 WP_000235792.1.100284 WP_000235792.1.100313 WP_000235792.1.100314 WP_000235792.1.100321 WP_000235792.1.100354 WP_000235792.1.100421 WP_000235792.1.100446 WP_000235792.1.100450 WP_000235792.1.100592 WP_000235792.1.100610 WP_000235792.1.100732 WP_000235792.1.100733 WP_000235792.1.100739 WP_000235792.1.100764 WP_000235792.1.100799 WP_000235792.1.100941 WP_000235792.1.100953 WP_000235792.1.101011 WP_000235792.1.10108 WP_000235792.1.101226 WP_000235792.1.10124 WP_000235792.1.101271 WP_000235792.1.101312 WP_000235792.1.101322 WP_000235792.1.101374 WP_000235792.1.101616 WP_000235792.1.101890 WP_000235792.1.101941 WP_000235792.1.102050 WP_000235792.1.102087 WP_000235792.1.10338 WP_000235792.1.1038 WP_000235792.1.104 WP_000235792.1.10401 WP_000235792.1.10428 WP_000235792.1.10459 WP_000235792.1.10475 WP_000235792.1.10514 WP_000235792.1.10530 WP_000235792.1.10532 WP_000235792.1.10547 WP_000235792.1.10595 WP_000235792.1.10642 WP_000235792.1.10654 WP_000235792.1.10677 WP_000235792.1.10857 WP_000235792.1.10873 WP_000235792.1.10926 WP_000235792.1.10936 WP_000235792.1.11012 WP_000235792.1.11055 WP_000235792.1.11126 WP_000235792.1.11142 WP_000235792.1.11239 WP_000235792.1.11253 WP_000235792.1.11314 WP_000235792.1.11385 WP_000235792.1.1142 WP_000235792.1.11426 WP_000235792.1.11429 WP_000235792.1.11557 WP_000235792.1.11638 WP_000235792.1.11883 WP_000235792.1.11908 WP_000235792.1.11914 WP_000235792.1.12040 WP_000235792.1.12061 WP_000235792.1.1207 WP_000235792.1.12141 WP_000235792.1.12172 WP_000235792.1.12192 WP_000235792.1.1224 WP_000235792.1.12364 WP_000235792.1.12398 WP_000235792.1.12441 WP_000235792.1.12581 WP_000235792.1.12620 WP_000235792.1.12648 WP_000235792.1.12683 WP_000235792.1.12726 WP_000235792.1.12727 WP_000235792.1.12741 WP_000235792.1.12834 WP_000235792.1.13108 WP_000235792.1.13161 WP_000235792.1.1321 WP_000235792.1.13268 WP_000235792.1.13291 WP_000235792.1.133 WP_000235792.1.13314 WP_000235792.1.13338 WP_000235792.1.13342 WP_000235792.1.13352 WP_000235792.1.13406 WP_000235792.1.13440 WP_000235792.1.13476 WP_000235792.1.13599 WP_000235792.1.13686 WP_000235792.1.1372 WP_000235792.1.13732 WP_000235792.1.1382 WP_000235792.1.13972 WP_000235792.1.140 WP_000235792.1.1401 WP_000235792.1.1408 WP_000235792.1.14089 WP_000235792.1.14099 WP_000235792.1.14120 WP_000235792.1.14123 WP_000235792.1.14150 WP_000235792.1.14191 WP_000235792.1.14197 WP_000235792.1.14280 WP_000235792.1.14333 WP_000235792.1.14399 WP_000235792.1.14444 WP_000235792.1.14467 WP_000235792.1.14474 WP_000235792.1.14500 WP_000235792.1.14526 WP_000235792.1.14550 WP_000235792.1.14575 WP_000235792.1.14701 WP_000235792.1.14703 WP_000235792.1.14719 WP_000235792.1.1473 WP_000235792.1.14765 WP_000235792.1.14810 WP_000235792.1.14877 WP_000235792.1.14894 WP_000235792.1.14930 WP_000235792.1.14947 WP_000235792.1.14948 WP_000235792.1.15184 WP_000235792.1.15244 WP_000235792.1.15265 WP_000235792.1.15362 WP_000235792.1.15415 WP_000235792.1.15423 WP_000235792.1.15433 WP_000235792.1.15439 WP_000235792.1.15487 WP_000235792.1.15535 WP_000235792.1.15581 WP_000235792.1.15597 WP_000235792.1.15710 WP_000235792.1.15717 WP_000235792.1.15905 WP_000235792.1.15912 WP_000235792.1.15970 WP_000235792.1.16046 WP_000235792.1.16051 WP_000235792.1.16058 WP_000235792.1.16150 WP_000235792.1.16155 WP_000235792.1.1626 WP_000235792.1.16264 WP_000235792.1.16344 WP_000235792.1.16452 WP_000235792.1.16461 WP_000235792.1.16462 WP_000235792.1.16465 WP_000235792.1.16522 WP_000235792.1.16588 WP_000235792.1.16658 WP_000235792.1.16666 WP_000235792.1.16673 WP_000235792.1.1674 WP_000235792.1.16767 WP_000235792.1.16781 WP_000235792.1.16879 WP_000235792.1.16893 WP_000235792.1.16948 WP_000235792.1.17049 WP_000235792.1.17058 WP_000235792.1.17078 WP_000235792.1.17202 WP_000235792.1.17219 WP_000235792.1.1722 WP_000235792.1.17302 WP_000235792.1.17308 WP_000235792.1.17368 WP_000235792.1.17405 WP_000235792.1.17406 WP_000235792.1.17513 WP_000235792.1.17543 WP_000235792.1.17563 WP_000235792.1.17578 WP_000235792.1.17622 WP_000235792.1.17659 WP_000235792.1.17667 WP_000235792.1.17686 WP_000235792.1.17741 WP_000235792.1.17840 WP_000235792.1.17956 WP_000235792.1.18005 WP_000235792.1.1801 WP_000235792.1.18021 WP_000235792.1.18099 WP_000235792.1.18124 WP_000235792.1.18144 WP_000235792.1.18173 WP_000235792.1.18270 WP_000235792.1.18280 WP_000235792.1.18328 WP_000235792.1.18358 WP_000235792.1.18370 WP_000235792.1.18406 WP_000235792.1.18474 WP_000235792.1.18513 WP_000235792.1.18610 WP_000235792.1.18678 WP_000235792.1.18722 WP_000235792.1.18766 WP_000235792.1.1880 WP_000235792.1.1885 WP_000235792.1.18860 WP_000235792.1.18922 WP_000235792.1.18959 WP_000235792.1.19001 WP_000235792.1.19006 WP_000235792.1.19044 WP_000235792.1.19084 WP_000235792.1.19187 WP_000235792.1.19228 WP_000235792.1.19288 WP_000235792.1.19300 WP_000235792.1.19422 WP_000235792.1.19454 WP_000235792.1.19456 WP_000235792.1.19496 WP_000235792.1.19535 WP_000235792.1.19538 WP_000235792.1.19589 WP_000235792.1.19663 WP_000235792.1.19686 WP_000235792.1.19731 WP_000235792.1.19794 WP_000235792.1.1992 WP_000235792.1.19999 WP_000235792.1.20254 WP_000235792.1.20255 WP_000235792.1.20296 WP_000235792.1.20339 WP_000235792.1.20419 WP_000235792.1.20465 WP_000235792.1.20492 WP_000235792.1.2053 WP_000235792.1.20635 WP_000235792.1.20718 WP_000235792.1.2073 WP_000235792.1.20740 WP_000235792.1.20828 WP_000235792.1.20883 WP_000235792.1.20947 WP_000235792.1.20953 WP_000235792.1.21010 WP_000235792.1.2106 WP_000235792.1.21062 WP_000235792.1.21144 WP_000235792.1.21162 WP_000235792.1.21184 WP_000235792.1.21185 WP_000235792.1.21366 WP_000235792.1.21492 WP_000235792.1.2166 WP_000235792.1.21674 WP_000235792.1.21946 WP_000235792.1.21966 WP_000235792.1.22064 WP_000235792.1.22118 WP_000235792.1.22126 WP_000235792.1.2216 WP_000235792.1.22208 WP_000235792.1.2227 WP_000235792.1.22373 WP_000235792.1.22476 WP_000235792.1.22614 WP_000235792.1.22652 WP_000235792.1.22683 WP_000235792.1.2284 WP_000235792.1.22895 WP_000235792.1.22926 WP_000235792.1.22943 WP_000235792.1.22967 WP_000235792.1.23040 WP_000235792.1.23058 WP_000235792.1.23218 WP_000235792.1.2331 WP_000235792.1.2332 WP_000235792.1.23340 WP_000235792.1.2336 WP_000235792.1.23365 WP_000235792.1.23412 WP_000235792.1.23426 WP_000235792.1.23492 WP_000235792.1.23515 WP_000235792.1.23548 WP_000235792.1.23571 WP_000235792.1.23604 WP_000235792.1.23679 WP_000235792.1.23728 WP_000235792.1.2375 WP_000235792.1.23783 WP_000235792.1.23786 WP_000235792.1.23787 WP_000235792.1.23801 WP_000235792.1.24028 WP_000235792.1.24061 WP_000235792.1.24083 WP_000235792.1.24117 WP_000235792.1.24125 WP_000235792.1.24138 WP_000235792.1.24153 WP_000235792.1.24291 WP_000235792.1.24322 WP_000235792.1.24355 WP_000235792.1.24375 WP_000235792.1.24400 WP_000235792.1.24420 WP_000235792.1.24619 WP_000235792.1.24643 WP_000235792.1.24688 WP_000235792.1.24716 WP_000235792.1.2481 WP_000235792.1.24832 WP_000235792.1.24964 WP_000235792.1.25017 WP_000235792.1.25032 WP_000235792.1.25041 WP_000235792.1.25053 WP_000235792.1.25140 WP_000235792.1.25185 WP_000235792.1.25196 WP_000235792.1.25210 WP_000235792.1.25219 WP_000235792.1.25304 WP_000235792.1.25374 WP_000235792.1.25475 WP_000235792.1.25490 WP_000235792.1.25508 WP_000235792.1.25512 WP_000235792.1.25603 WP_000235792.1.2562 WP_000235792.1.25666 WP_000235792.1.25807 WP_000235792.1.25821 WP_000235792.1.25833 WP_000235792.1.25835 WP_000235792.1.25882 WP_000235792.1.25911 WP_000235792.1.25962 WP_000235792.1.25963 WP_000235792.1.26001 WP_000235792.1.26027 WP_000235792.1.26107 WP_000235792.1.2615 WP_000235792.1.26217 WP_000235792.1.26230 WP_000235792.1.26232 WP_000235792.1.26272 WP_000235792.1.26286 WP_000235792.1.26288 WP_000235792.1.26394 WP_000235792.1.26491 WP_000235792.1.2654 WP_000235792.1.26554 WP_000235792.1.26636 WP_000235792.1.26689 WP_000235792.1.2679 WP_000235792.1.26908 WP_000235792.1.2692 WP_000235792.1.26928 WP_000235792.1.270 WP_000235792.1.27008 WP_000235792.1.27027 WP_000235792.1.27070 WP_000235792.1.27077 WP_000235792.1.27086 WP_000235792.1.27087 WP_000235792.1.27111 WP_000235792.1.27115 WP_000235792.1.2713 WP_000235792.1.2717 WP_000235792.1.27228 WP_000235792.1.27282 WP_000235792.1.27285 WP_000235792.1.27309 WP_000235792.1.27329 WP_000235792.1.27361 WP_000235792.1.27565 WP_000235792.1.27595 WP_000235792.1.27598 WP_000235792.1.27706 WP_000235792.1.27775 WP_000235792.1.27785 WP_000235792.1.27900 WP_000235792.1.27928 WP_000235792.1.27945 WP_000235792.1.28004 WP_000235792.1.2809 WP_000235792.1.28155 WP_000235792.1.28198 WP_000235792.1.2822 WP_000235792.1.28229 WP_000235792.1.28384 WP_000235792.1.28386 WP_000235792.1.28395 WP_000235792.1.284 WP_000235792.1.2845 WP_000235792.1.28479 WP_000235792.1.28627 WP_000235792.1.28692 WP_000235792.1.2873 WP_000235792.1.28917 WP_000235792.1.28962 WP_000235792.1.29023 WP_000235792.1.29042 WP_000235792.1.2905 WP_000235792.1.2907 WP_000235792.1.29081 WP_000235792.1.29089 WP_000235792.1.29153 WP_000235792.1.29203 WP_000235792.1.29237 WP_000235792.1.29248 WP_000235792.1.29288 WP_000235792.1.29389 WP_000235792.1.29439 WP_000235792.1.2946 WP_000235792.1.29462 WP_000235792.1.29727 WP_000235792.1.29743 WP_000235792.1.29782 WP_000235792.1.29833 WP_000235792.1.29851 WP_000235792.1.29865 WP_000235792.1.29886 WP_000235792.1.29919 WP_000235792.1.2994 WP_000235792.1.29964 WP_000235792.1.29983 WP_000235792.1.30009 WP_000235792.1.30013 WP_000235792.1.3002 WP_000235792.1.30034 WP_000235792.1.30049 WP_000235792.1.30058 WP_000235792.1.30172 WP_000235792.1.30185 WP_000235792.1.30354 WP_000235792.1.30357 WP_000235792.1.30362 WP_000235792.1.3042 WP_000235792.1.30421 WP_000235792.1.30440 WP_000235792.1.30448 WP_000235792.1.30489 WP_000235792.1.30517 WP_000235792.1.30542 WP_000235792.1.30544 WP_000235792.1.30556 WP_000235792.1.30572 WP_000235792.1.30585 WP_000235792.1.30618 WP_000235792.1.30664 WP_000235792.1.30688 WP_000235792.1.30806 WP_000235792.1.30967 WP_000235792.1.31046 WP_000235792.1.31066 WP_000235792.1.31078 WP_000235792.1.31139 WP_000235792.1.31145 WP_000235792.1.31182 WP_000235792.1.31205 WP_000235792.1.3121 WP_000235792.1.31223 WP_000235792.1.31303 WP_000235792.1.3131 WP_000235792.1.31352 WP_000235792.1.31389 WP_000235792.1.31413 WP_000235792.1.31446 WP_000235792.1.31533 WP_000235792.1.31799 WP_000235792.1.31836 WP_000235792.1.31951 WP_000235792.1.32041 WP_000235792.1.32042 WP_000235792.1.3207 WP_000235792.1.32189 WP_000235792.1.32202 WP_000235792.1.32263 WP_000235792.1.32293 WP_000235792.1.32299 WP_000235792.1.32422 WP_000235792.1.32425 WP_000235792.1.32458 WP_000235792.1.32460 WP_000235792.1.32529 WP_000235792.1.32563 WP_000235792.1.32578 WP_000235792.1.32617 WP_000235792.1.3270 WP_000235792.1.32725 WP_000235792.1.32838 WP_000235792.1.32848 WP_000235792.1.32868 WP_000235792.1.32940 WP_000235792.1.32941 WP_000235792.1.3296 WP_000235792.1.32966 WP_000235792.1.32985 WP_000235792.1.33037 WP_000235792.1.3305 WP_000235792.1.33051 WP_000235792.1.33065 WP_000235792.1.33122 WP_000235792.1.3315 WP_000235792.1.33208 WP_000235792.1.33214 WP_000235792.1.33247 WP_000235792.1.33280 WP_000235792.1.33283 WP_000235792.1.33313 WP_000235792.1.33339 WP_000235792.1.33382 WP_000235792.1.33490 WP_000235792.1.33501 WP_000235792.1.33529 WP_000235792.1.33689 WP_000235792.1.3370 WP_000235792.1.33730 WP_000235792.1.33741 WP_000235792.1.33840 WP_000235792.1.3392 WP_000235792.1.33926 WP_000235792.1.33957 WP_000235792.1.33969 WP_000235792.1.34001 WP_000235792.1.34059 WP_000235792.1.34118 WP_000235792.1.34211 WP_000235792.1.34214 WP_000235792.1.34234 WP_000235792.1.34284 WP_000235792.1.34376 WP_000235792.1.34382 WP_000235792.1.34484 WP_000235792.1.34517 WP_000235792.1.34530 WP_000235792.1.34665 WP_000235792.1.34694 WP_000235792.1.34751 WP_000235792.1.34824 WP_000235792.1.34834 WP_000235792.1.34932 WP_000235792.1.34962 WP_000235792.1.35001 WP_000235792.1.35040 WP_000235792.1.35074 WP_000235792.1.35175 WP_000235792.1.35240 WP_000235792.1.35274 WP_000235792.1.35532 WP_000235792.1.35560 WP_000235792.1.3557 WP_000235792.1.35628 WP_000235792.1.3570 WP_000235792.1.35712 WP_000235792.1.35713 WP_000235792.1.35736 WP_000235792.1.35791 WP_000235792.1.35795 WP_000235792.1.35870 WP_000235792.1.35916 WP_000235792.1.35938 WP_000235792.1.35966 WP_000235792.1.36000 WP_000235792.1.36034 WP_000235792.1.36036 WP_000235792.1.36069 WP_000235792.1.36291 WP_000235792.1.36298 WP_000235792.1.36308 WP_000235792.1.36323 WP_000235792.1.36343 WP_000235792.1.36460 WP_000235792.1.3649 WP_000235792.1.36495 WP_000235792.1.36526 WP_000235792.1.36567 WP_000235792.1.36579 WP_000235792.1.36617 WP_000235792.1.36618 WP_000235792.1.36643 WP_000235792.1.36663 WP_000235792.1.36701 WP_000235792.1.36725 WP_000235792.1.36779 WP_000235792.1.36798 WP_000235792.1.36821 WP_000235792.1.36853 WP_000235792.1.36950 WP_000235792.1.37014 WP_000235792.1.37133 WP_000235792.1.37176 WP_000235792.1.37199 WP_000235792.1.37200 WP_000235792.1.37258 WP_000235792.1.37303 WP_000235792.1.37513 WP_000235792.1.37584 WP_000235792.1.37590 WP_000235792.1.37593 WP_000235792.1.37600 WP_000235792.1.37613 WP_000235792.1.37659 WP_000235792.1.37662 WP_000235792.1.37675 WP_000235792.1.37691 WP_000235792.1.37761 WP_000235792.1.37775 WP_000235792.1.37777 WP_000235792.1.378 WP_000235792.1.379 WP_000235792.1.37911 WP_000235792.1.37941 WP_000235792.1.37985 WP_000235792.1.38061 WP_000235792.1.38064 WP_000235792.1.38108 WP_000235792.1.3816 WP_000235792.1.38207 WP_000235792.1.38261 WP_000235792.1.38266 WP_000235792.1.38310 WP_000235792.1.3834 WP_000235792.1.38351 WP_000235792.1.3838 WP_000235792.1.38381 WP_000235792.1.38440 WP_000235792.1.38486 WP_000235792.1.38515 WP_000235792.1.38595 WP_000235792.1.3860 WP_000235792.1.38642 WP_000235792.1.38734 WP_000235792.1.38877 WP_000235792.1.38983 WP_000235792.1.38996 WP_000235792.1.39056 WP_000235792.1.3907 WP_000235792.1.39105 WP_000235792.1.3914 WP_000235792.1.39147 WP_000235792.1.39161 WP_000235792.1.39210 WP_000235792.1.39235 WP_000235792.1.3931 WP_000235792.1.39435 WP_000235792.1.39502 WP_000235792.1.39530 WP_000235792.1.39619 WP_000235792.1.39620 WP_000235792.1.39624 WP_000235792.1.39659 WP_000235792.1.39667 WP_000235792.1.39775 WP_000235792.1.39879 WP_000235792.1.39890 WP_000235792.1.39941 WP_000235792.1.39945 WP_000235792.1.39947 WP_000235792.1.40095 WP_000235792.1.40097 WP_000235792.1.401 WP_000235792.1.40160 WP_000235792.1.40167 WP_000235792.1.40279 WP_000235792.1.40361 WP_000235792.1.4042 WP_000235792.1.40467 WP_000235792.1.40517 WP_000235792.1.40698 WP_000235792.1.40750 WP_000235792.1.40763 WP_000235792.1.40854 WP_000235792.1.4089 WP_000235792.1.40924 WP_000235792.1.40932 WP_000235792.1.40946 WP_000235792.1.41004 WP_000235792.1.4106 WP_000235792.1.41070 WP_000235792.1.41074 WP_000235792.1.41075 WP_000235792.1.41097 WP_000235792.1.41132 WP_000235792.1.41176 WP_000235792.1.41251 WP_000235792.1.41258 WP_000235792.1.41305 WP_000235792.1.41321 WP_000235792.1.41333 WP_000235792.1.41335 WP_000235792.1.4136 WP_000235792.1.41415 WP_000235792.1.41459 WP_000235792.1.41498 WP_000235792.1.41519 WP_000235792.1.41524 WP_000235792.1.41631 WP_000235792.1.41658 WP_000235792.1.41659 WP_000235792.1.41716 WP_000235792.1.41746 WP_000235792.1.41824 WP_000235792.1.41825 WP_000235792.1.41836 WP_000235792.1.41894 WP_000235792.1.41919 WP_000235792.1.41929 WP_000235792.1.4194 WP_000235792.1.42069 WP_000235792.1.42081 WP_000235792.1.42090 WP_000235792.1.42111 WP_000235792.1.42187 WP_000235792.1.42200 WP_000235792.1.42219 WP_000235792.1.42261 WP_000235792.1.42349 WP_000235792.1.42364 WP_000235792.1.42371 WP_000235792.1.42379 WP_000235792.1.42391 WP_000235792.1.42399 WP_000235792.1.42539 WP_000235792.1.42603 WP_000235792.1.42650 WP_000235792.1.4267 WP_000235792.1.42701 WP_000235792.1.42805 WP_000235792.1.42815 WP_000235792.1.42859 WP_000235792.1.4298 WP_000235792.1.43008 WP_000235792.1.43016 WP_000235792.1.43019 WP_000235792.1.43065 WP_000235792.1.43068 WP_000235792.1.43069 WP_000235792.1.43141 WP_000235792.1.43157 WP_000235792.1.43161 WP_000235792.1.43190 WP_000235792.1.43198 WP_000235792.1.4326 WP_000235792.1.43290 WP_000235792.1.43292 WP_000235792.1.43307 WP_000235792.1.43513 WP_000235792.1.43633 WP_000235792.1.43637 WP_000235792.1.43651 WP_000235792.1.43801 WP_000235792.1.43812 WP_000235792.1.43878 WP_000235792.1.43888 WP_000235792.1.43919 WP_000235792.1.43974 WP_000235792.1.44049 WP_000235792.1.44101 WP_000235792.1.44160 WP_000235792.1.44196 WP_000235792.1.44248 WP_000235792.1.44262 WP_000235792.1.44268 WP_000235792.1.4427 WP_000235792.1.44296 WP_000235792.1.44343 WP_000235792.1.44351 WP_000235792.1.44360 WP_000235792.1.44416 WP_000235792.1.44431 WP_000235792.1.44437 WP_000235792.1.44546 WP_000235792.1.4468 WP_000235792.1.44762 WP_000235792.1.44815 WP_000235792.1.44828 WP_000235792.1.44879 WP_000235792.1.44917 WP_000235792.1.4501 WP_000235792.1.45072 WP_000235792.1.45093 WP_000235792.1.45136 WP_000235792.1.45241 WP_000235792.1.45435 WP_000235792.1.45523 WP_000235792.1.45596 WP_000235792.1.45648 WP_000235792.1.45829 WP_000235792.1.45871 WP_000235792.1.46030 WP_000235792.1.46077 WP_000235792.1.46169 WP_000235792.1.46225 WP_000235792.1.46241 WP_000235792.1.46307 WP_000235792.1.46355 WP_000235792.1.464 WP_000235792.1.46454 WP_000235792.1.46461 WP_000235792.1.46504 WP_000235792.1.46505 WP_000235792.1.46551 WP_000235792.1.46701 WP_000235792.1.46781 WP_000235792.1.46816 WP_000235792.1.46842 WP_000235792.1.4690 WP_000235792.1.46920 WP_000235792.1.46945 WP_000235792.1.47036 WP_000235792.1.47037 WP_000235792.1.47042 WP_000235792.1.47059 WP_000235792.1.47085 WP_000235792.1.47123 WP_000235792.1.47215 WP_000235792.1.47523 WP_000235792.1.47531 WP_000235792.1.47532 WP_000235792.1.47605 WP_000235792.1.47630 WP_000235792.1.4774 WP_000235792.1.47756 WP_000235792.1.4781 WP_000235792.1.47886 WP_000235792.1.47898 WP_000235792.1.48019 WP_000235792.1.48100 WP_000235792.1.48114 WP_000235792.1.48139 WP_000235792.1.48190 WP_000235792.1.48292 WP_000235792.1.48324 WP_000235792.1.48426 WP_000235792.1.48430 WP_000235792.1.48436 WP_000235792.1.48586 WP_000235792.1.4859 WP_000235792.1.48591 WP_000235792.1.48610 WP_000235792.1.48631 WP_000235792.1.48663 WP_000235792.1.48690 WP_000235792.1.48734 WP_000235792.1.48756 WP_000235792.1.48778 WP_000235792.1.48849 WP_000235792.1.48955 WP_000235792.1.48963 WP_000235792.1.48973 WP_000235792.1.49004 WP_000235792.1.49106 WP_000235792.1.49117 WP_000235792.1.49121 WP_000235792.1.49140 WP_000235792.1.49153 WP_000235792.1.49166 WP_000235792.1.49355 WP_000235792.1.49429 WP_000235792.1.49434 WP_000235792.1.49450 WP_000235792.1.495 WP_000235792.1.49545 WP_000235792.1.49703 WP_000235792.1.49769 WP_000235792.1.49846 WP_000235792.1.4991 WP_000235792.1.49947 WP_000235792.1.49959 WP_000235792.1.49997 WP_000235792.1.50014 WP_000235792.1.50030 WP_000235792.1.50043 WP_000235792.1.50103 WP_000235792.1.50158 WP_000235792.1.50247 WP_000235792.1.50308 WP_000235792.1.50309 WP_000235792.1.50387 WP_000235792.1.50406 WP_000235792.1.50468 WP_000235792.1.5051 WP_000235792.1.50566 WP_000235792.1.50570 WP_000235792.1.50626 WP_000235792.1.50771 WP_000235792.1.50875 WP_000235792.1.50885 WP_000235792.1.509 WP_000235792.1.50929 WP_000235792.1.50970 WP_000235792.1.51040 WP_000235792.1.51048 WP_000235792.1.51100 WP_000235792.1.51134 WP_000235792.1.51227 WP_000235792.1.5127 WP_000235792.1.51305 WP_000235792.1.51315 WP_000235792.1.5136 WP_000235792.1.51474 WP_000235792.1.51519 WP_000235792.1.51598 WP_000235792.1.51644 WP_000235792.1.51724 WP_000235792.1.51734 WP_000235792.1.51838 WP_000235792.1.51863 WP_000235792.1.51935 WP_000235792.1.52057 WP_000235792.1.52114 WP_000235792.1.52129 WP_000235792.1.52202 WP_000235792.1.52209 WP_000235792.1.52339 WP_000235792.1.52469 WP_000235792.1.52571 WP_000235792.1.526 WP_000235792.1.52647 WP_000235792.1.52742 WP_000235792.1.52773 WP_000235792.1.52795 WP_000235792.1.52807 WP_000235792.1.52887 WP_000235792.1.53092 WP_000235792.1.53141 WP_000235792.1.53151 WP_000235792.1.53154 WP_000235792.1.53159 WP_000235792.1.53210 WP_000235792.1.53233 WP_000235792.1.53307 WP_000235792.1.53321 WP_000235792.1.53368 WP_000235792.1.53375 WP_000235792.1.53450 WP_000235792.1.5349 WP_000235792.1.53540 WP_000235792.1.53555 WP_000235792.1.53559 WP_000235792.1.5356 WP_000235792.1.53571 WP_000235792.1.5358 WP_000235792.1.53692 WP_000235792.1.53723 WP_000235792.1.5374 WP_000235792.1.53750 WP_000235792.1.53800 WP_000235792.1.53815 WP_000235792.1.53839 WP_000235792.1.53892 WP_000235792.1.53898 WP_000235792.1.53902 WP_000235792.1.53958 WP_000235792.1.53981 WP_000235792.1.53984 WP_000235792.1.54132 WP_000235792.1.54170 WP_000235792.1.54175 WP_000235792.1.54203 WP_000235792.1.54259 WP_000235792.1.5430 WP_000235792.1.54371 WP_000235792.1.54431 WP_000235792.1.54442 WP_000235792.1.54482 WP_000235792.1.54589 WP_000235792.1.54667 WP_000235792.1.54678 WP_000235792.1.54681 WP_000235792.1.54748 WP_000235792.1.5481 WP_000235792.1.54865 WP_000235792.1.54935 WP_000235792.1.54979 WP_000235792.1.55010 WP_000235792.1.55034 WP_000235792.1.55163 WP_000235792.1.55165 WP_000235792.1.55215 WP_000235792.1.55290 WP_000235792.1.55310 WP_000235792.1.55317 WP_000235792.1.55379 WP_000235792.1.5539 WP_000235792.1.55468 WP_000235792.1.55506 WP_000235792.1.55604 WP_000235792.1.55639 WP_000235792.1.55699 WP_000235792.1.55725 WP_000235792.1.55780 WP_000235792.1.55967 WP_000235792.1.56144 WP_000235792.1.56172 WP_000235792.1.5621 WP_000235792.1.56226 WP_000235792.1.56311 WP_000235792.1.56419 WP_000235792.1.56423 WP_000235792.1.56514 WP_000235792.1.56535 WP_000235792.1.56585 WP_000235792.1.56640 WP_000235792.1.56724 WP_000235792.1.56825 WP_000235792.1.56887 WP_000235792.1.56889 WP_000235792.1.56981 WP_000235792.1.57101 WP_000235792.1.57137 WP_000235792.1.57147 WP_000235792.1.57179 WP_000235792.1.57186 WP_000235792.1.57342 WP_000235792.1.57684 WP_000235792.1.57699 WP_000235792.1.57785 WP_000235792.1.57800 WP_000235792.1.57873 WP_000235792.1.57965 WP_000235792.1.57972 WP_000235792.1.58008 WP_000235792.1.58044 WP_000235792.1.58081 WP_000235792.1.5809 WP_000235792.1.58132 WP_000235792.1.58173 WP_000235792.1.58191 WP_000235792.1.58194 WP_000235792.1.58252 WP_000235792.1.58261 WP_000235792.1.58274 WP_000235792.1.58282 WP_000235792.1.58324 WP_000235792.1.58326 WP_000235792.1.5836 WP_000235792.1.58485 WP_000235792.1.58537 WP_000235792.1.58568 WP_000235792.1.58583 WP_000235792.1.58652 WP_000235792.1.58663 WP_000235792.1.58724 WP_000235792.1.5875 WP_000235792.1.58796 WP_000235792.1.58807 WP_000235792.1.58847 WP_000235792.1.58883 WP_000235792.1.58898 WP_000235792.1.58949 WP_000235792.1.58963 WP_000235792.1.58970 WP_000235792.1.58974 WP_000235792.1.59020 WP_000235792.1.59043 WP_000235792.1.59056 WP_000235792.1.59061 WP_000235792.1.59064 WP_000235792.1.59282 WP_000235792.1.59299 WP_000235792.1.59313 WP_000235792.1.5949 WP_000235792.1.59501 WP_000235792.1.59510 WP_000235792.1.5969 WP_000235792.1.59751 WP_000235792.1.59827 WP_000235792.1.59829 WP_000235792.1.59847 WP_000235792.1.59863 WP_000235792.1.59969 WP_000235792.1.59994 WP_000235792.1.60045 WP_000235792.1.60076 WP_000235792.1.60114 WP_000235792.1.60154 WP_000235792.1.60168 WP_000235792.1.60192 WP_000235792.1.60199 WP_000235792.1.60212 WP_000235792.1.60253 WP_000235792.1.60322 WP_000235792.1.60324 WP_000235792.1.60356 WP_000235792.1.6038 WP_000235792.1.60380 WP_000235792.1.6041 WP_000235792.1.60424 WP_000235792.1.60481 WP_000235792.1.605 WP_000235792.1.6058 WP_000235792.1.60584 WP_000235792.1.6060 WP_000235792.1.60676 WP_000235792.1.60708 WP_000235792.1.60725 WP_000235792.1.60783 WP_000235792.1.60792 WP_000235792.1.60807 WP_000235792.1.60882 WP_000235792.1.60889 WP_000235792.1.60950 WP_000235792.1.6104 WP_000235792.1.61044 WP_000235792.1.61076 WP_000235792.1.61123 WP_000235792.1.61147 WP_000235792.1.61168 WP_000235792.1.61210 WP_000235792.1.61357 WP_000235792.1.61511 WP_000235792.1.61542 WP_000235792.1.61553 WP_000235792.1.61649 WP_000235792.1.61652 WP_000235792.1.61697 WP_000235792.1.61809 WP_000235792.1.61877 WP_000235792.1.61920 WP_000235792.1.62124 WP_000235792.1.62199 WP_000235792.1.62223 WP_000235792.1.62302 WP_000235792.1.62314 WP_000235792.1.62323 WP_000235792.1.62333 WP_000235792.1.62338 WP_000235792.1.62380 WP_000235792.1.62411 WP_000235792.1.62436 WP_000235792.1.62475 WP_000235792.1.62536 WP_000235792.1.62640 WP_000235792.1.62686 WP_000235792.1.62751 WP_000235792.1.62825 WP_000235792.1.62913 WP_000235792.1.62932 WP_000235792.1.62960 WP_000235792.1.63016 WP_000235792.1.63025 WP_000235792.1.63069 WP_000235792.1.63087 WP_000235792.1.63169 WP_000235792.1.63297 WP_000235792.1.63448 WP_000235792.1.63514 WP_000235792.1.63583 WP_000235792.1.63592 WP_000235792.1.63663 WP_000235792.1.63736 WP_000235792.1.63816 WP_000235792.1.6389 WP_000235792.1.63901 WP_000235792.1.63955 WP_000235792.1.63963 WP_000235792.1.64032 WP_000235792.1.64087 WP_000235792.1.6415 WP_000235792.1.64293 WP_000235792.1.64332 WP_000235792.1.64376 WP_000235792.1.644 WP_000235792.1.64471 WP_000235792.1.64501 WP_000235792.1.64538 WP_000235792.1.64632 WP_000235792.1.64648 WP_000235792.1.64654 WP_000235792.1.64662 WP_000235792.1.64663 WP_000235792.1.64709 WP_000235792.1.64710 WP_000235792.1.64744 WP_000235792.1.64817 WP_000235792.1.64847 WP_000235792.1.6487 WP_000235792.1.64891 WP_000235792.1.64974 WP_000235792.1.65054 WP_000235792.1.65075 WP_000235792.1.65172 WP_000235792.1.65191 WP_000235792.1.65200 WP_000235792.1.65211 WP_000235792.1.65218 WP_000235792.1.65226 WP_000235792.1.65249 WP_000235792.1.65266 WP_000235792.1.65395 WP_000235792.1.65459 WP_000235792.1.65463 WP_000235792.1.65487 WP_000235792.1.6549 WP_000235792.1.65499 WP_000235792.1.6554 WP_000235792.1.65650 WP_000235792.1.65697 WP_000235792.1.65699 WP_000235792.1.65737 WP_000235792.1.65755 WP_000235792.1.65812 WP_000235792.1.65846 WP_000235792.1.65863 WP_000235792.1.65985 WP_000235792.1.66021 WP_000235792.1.66031 WP_000235792.1.66052 WP_000235792.1.66064 WP_000235792.1.66109 WP_000235792.1.66145 WP_000235792.1.66183 WP_000235792.1.6620 WP_000235792.1.66216 WP_000235792.1.66234 WP_000235792.1.66273 WP_000235792.1.66324 WP_000235792.1.6634 WP_000235792.1.66361 WP_000235792.1.66480 WP_000235792.1.66506 WP_000235792.1.66665 WP_000235792.1.66681 WP_000235792.1.66684 WP_000235792.1.66755 WP_000235792.1.66759 WP_000235792.1.66860 WP_000235792.1.66953 WP_000235792.1.66955 WP_000235792.1.66981 WP_000235792.1.67024 WP_000235792.1.67042 WP_000235792.1.67101 WP_000235792.1.67143 WP_000235792.1.67201 WP_000235792.1.67211 WP_000235792.1.67237 WP_000235792.1.67336 WP_000235792.1.67339 WP_000235792.1.67387 WP_000235792.1.67394 WP_000235792.1.67397 WP_000235792.1.67403 WP_000235792.1.67430 WP_000235792.1.67442 WP_000235792.1.67539 WP_000235792.1.67556 WP_000235792.1.67576 WP_000235792.1.67604 WP_000235792.1.67619 WP_000235792.1.67625 WP_000235792.1.67627 WP_000235792.1.67641 WP_000235792.1.67657 WP_000235792.1.67673 WP_000235792.1.67700 WP_000235792.1.67718 WP_000235792.1.67729 WP_000235792.1.67774 WP_000235792.1.67820 WP_000235792.1.67910 WP_000235792.1.67954 WP_000235792.1.68 WP_000235792.1.68043 WP_000235792.1.68105 WP_000235792.1.68113 WP_000235792.1.68131 WP_000235792.1.68182 WP_000235792.1.6819 WP_000235792.1.68285 WP_000235792.1.68359 WP_000235792.1.68420 WP_000235792.1.68514 WP_000235792.1.68564 WP_000235792.1.68688 WP_000235792.1.68742 WP_000235792.1.68770 WP_000235792.1.68809 WP_000235792.1.68914 WP_000235792.1.69053 WP_000235792.1.69170 WP_000235792.1.69210 WP_000235792.1.69270 WP_000235792.1.69282 WP_000235792.1.69376 WP_000235792.1.69396 WP_000235792.1.69466 WP_000235792.1.69611 WP_000235792.1.69642 WP_000235792.1.69656 WP_000235792.1.69657 WP_000235792.1.69690 WP_000235792.1.69923 WP_000235792.1.69948 WP_000235792.1.69953 WP_000235792.1.70010 WP_000235792.1.70049 WP_000235792.1.70058 WP_000235792.1.70061 WP_000235792.1.70205 WP_000235792.1.70240 WP_000235792.1.70249 WP_000235792.1.70261 WP_000235792.1.70314 WP_000235792.1.7033 WP_000235792.1.70427 WP_000235792.1.70433 WP_000235792.1.70545 WP_000235792.1.70623 WP_000235792.1.70671 WP_000235792.1.70679 WP_000235792.1.70708 WP_000235792.1.70717 WP_000235792.1.70731 WP_000235792.1.70772 WP_000235792.1.70845 WP_000235792.1.70846 WP_000235792.1.70981 WP_000235792.1.70995 WP_000235792.1.71039 WP_000235792.1.71057 WP_000235792.1.71081 WP_000235792.1.71117 WP_000235792.1.71186 WP_000235792.1.71455 WP_000235792.1.71456 WP_000235792.1.71487 WP_000235792.1.71523 WP_000235792.1.71542 WP_000235792.1.71566 WP_000235792.1.71640 WP_000235792.1.71651 WP_000235792.1.71653 WP_000235792.1.71716 WP_000235792.1.71872 WP_000235792.1.71950 WP_000235792.1.71954 WP_000235792.1.71985 WP_000235792.1.72003 WP_000235792.1.72073 WP_000235792.1.72269 WP_000235792.1.72350 WP_000235792.1.72383 WP_000235792.1.72461 WP_000235792.1.72527 WP_000235792.1.7255 WP_000235792.1.72631 WP_000235792.1.72638 WP_000235792.1.72667 WP_000235792.1.72674 WP_000235792.1.72724 WP_000235792.1.72789 WP_000235792.1.72896 WP_000235792.1.72969 WP_000235792.1.72987 WP_000235792.1.73052 WP_000235792.1.7311 WP_000235792.1.73114 WP_000235792.1.73177 WP_000235792.1.73180 WP_000235792.1.73258 WP_000235792.1.73285 WP_000235792.1.7332 WP_000235792.1.7333 WP_000235792.1.73352 WP_000235792.1.73389 WP_000235792.1.73488 WP_000235792.1.73504 WP_000235792.1.7353 WP_000235792.1.73544 WP_000235792.1.73598 WP_000235792.1.7361 WP_000235792.1.73648 WP_000235792.1.73768 WP_000235792.1.73849 WP_000235792.1.73948 WP_000235792.1.73999 WP_000235792.1.74024 WP_000235792.1.74030 WP_000235792.1.74038 WP_000235792.1.74043 WP_000235792.1.74058 WP_000235792.1.74070 WP_000235792.1.74077 WP_000235792.1.74135 WP_000235792.1.74214 WP_000235792.1.74241 WP_000235792.1.74285 WP_000235792.1.7430 WP_000235792.1.74317 WP_000235792.1.74415 WP_000235792.1.74616 WP_000235792.1.74621 WP_000235792.1.74647 WP_000235792.1.74677 WP_000235792.1.74699 WP_000235792.1.74831 WP_000235792.1.74894 WP_000235792.1.74929 WP_000235792.1.74939 WP_000235792.1.74973 WP_000235792.1.7507 WP_000235792.1.75089 WP_000235792.1.75116 WP_000235792.1.75237 WP_000235792.1.75273 WP_000235792.1.75296 WP_000235792.1.75413 WP_000235792.1.75433 WP_000235792.1.75532 WP_000235792.1.75565 WP_000235792.1.75593 WP_000235792.1.75610 WP_000235792.1.75633 WP_000235792.1.75718 WP_000235792.1.75745 WP_000235792.1.75844 WP_000235792.1.75886 WP_000235792.1.75898 WP_000235792.1.76081 WP_000235792.1.76116 WP_000235792.1.76122 WP_000235792.1.76256 WP_000235792.1.76339 WP_000235792.1.76366 WP_000235792.1.76417 WP_000235792.1.7646 WP_000235792.1.76510 WP_000235792.1.76558 WP_000235792.1.76572 WP_000235792.1.76641 WP_000235792.1.76651 WP_000235792.1.76653 WP_000235792.1.76788 WP_000235792.1.76916 WP_000235792.1.76932 WP_000235792.1.76973 WP_000235792.1.76988 WP_000235792.1.77016 WP_000235792.1.77087 WP_000235792.1.77090 WP_000235792.1.77111 WP_000235792.1.77299 WP_000235792.1.77384 WP_000235792.1.77501 WP_000235792.1.77512 WP_000235792.1.77513 WP_000235792.1.77563 WP_000235792.1.77702 WP_000235792.1.77713 WP_000235792.1.7772 WP_000235792.1.77825 WP_000235792.1.77837 WP_000235792.1.77900 WP_000235792.1.77923 WP_000235792.1.77975 WP_000235792.1.78035 WP_000235792.1.78048 WP_000235792.1.78107 WP_000235792.1.78166 WP_000235792.1.78192 WP_000235792.1.78195 WP_000235792.1.78291 WP_000235792.1.78309 WP_000235792.1.78320 WP_000235792.1.78382 WP_000235792.1.78388 WP_000235792.1.78410 WP_000235792.1.7862 WP_000235792.1.78626 WP_000235792.1.78661 WP_000235792.1.78674 WP_000235792.1.78676 WP_000235792.1.78761 WP_000235792.1.789 WP_000235792.1.78993 WP_000235792.1.79012 WP_000235792.1.79069 WP_000235792.1.79074 WP_000235792.1.79098 WP_000235792.1.79155 WP_000235792.1.79164 WP_000235792.1.79204 WP_000235792.1.79280 WP_000235792.1.79397 WP_000235792.1.79456 WP_000235792.1.79532 WP_000235792.1.79547 WP_000235792.1.79654 WP_000235792.1.7970 WP_000235792.1.79722 WP_000235792.1.79772 WP_000235792.1.79880 WP_000235792.1.79916 WP_000235792.1.80065 WP_000235792.1.80103 WP_000235792.1.80273 WP_000235792.1.80282 WP_000235792.1.80354 WP_000235792.1.80368 WP_000235792.1.80386 WP_000235792.1.80462 WP_000235792.1.8049 WP_000235792.1.80492 WP_000235792.1.80569 WP_000235792.1.80664 WP_000235792.1.80696 WP_000235792.1.80984 WP_000235792.1.81131 WP_000235792.1.81187 WP_000235792.1.81262 WP_000235792.1.81268 WP_000235792.1.81269 WP_000235792.1.81271 WP_000235792.1.8131 WP_000235792.1.81333 WP_000235792.1.81342 WP_000235792.1.81364 WP_000235792.1.81494 WP_000235792.1.81557 WP_000235792.1.81676 WP_000235792.1.8170 WP_000235792.1.81763 WP_000235792.1.81855 WP_000235792.1.81921 WP_000235792.1.81931 WP_000235792.1.81936 WP_000235792.1.81949 WP_000235792.1.82070 WP_000235792.1.82076 WP_000235792.1.82156 WP_000235792.1.8218 WP_000235792.1.82201 WP_000235792.1.82214 WP_000235792.1.82225 WP_000235792.1.8240 WP_000235792.1.82408 WP_000235792.1.82416 WP_000235792.1.8242 WP_000235792.1.82456 WP_000235792.1.82465 WP_000235792.1.82473 WP_000235792.1.82553 WP_000235792.1.82646 WP_000235792.1.82670 WP_000235792.1.82731 WP_000235792.1.82812 WP_000235792.1.82850 WP_000235792.1.82872 WP_000235792.1.8294 WP_000235792.1.82959 WP_000235792.1.8304 WP_000235792.1.83180 WP_000235792.1.83229 WP_000235792.1.83235 WP_000235792.1.83290 WP_000235792.1.83333 WP_000235792.1.83657 WP_000235792.1.83677 WP_000235792.1.8375 WP_000235792.1.83923 WP_000235792.1.83994 WP_000235792.1.84 WP_000235792.1.8406 WP_000235792.1.84076 WP_000235792.1.84110 WP_000235792.1.84127 WP_000235792.1.84150 WP_000235792.1.84230 WP_000235792.1.84252 WP_000235792.1.8431 WP_000235792.1.84345 WP_000235792.1.84401 WP_000235792.1.84435 WP_000235792.1.84567 WP_000235792.1.84631 WP_000235792.1.84727 WP_000235792.1.84744 WP_000235792.1.84773 WP_000235792.1.84945 WP_000235792.1.84967 WP_000235792.1.85004 WP_000235792.1.8502 WP_000235792.1.85039 WP_000235792.1.85153 WP_000235792.1.85273 WP_000235792.1.85338 WP_000235792.1.85339 WP_000235792.1.85511 WP_000235792.1.85512 WP_000235792.1.8557 WP_000235792.1.85606 WP_000235792.1.85635 WP_000235792.1.85646 WP_000235792.1.85665 WP_000235792.1.85669 WP_000235792.1.85688 WP_000235792.1.85703 WP_000235792.1.85728 WP_000235792.1.85746 WP_000235792.1.85811 WP_000235792.1.859 WP_000235792.1.85917 WP_000235792.1.8594 WP_000235792.1.85977 WP_000235792.1.860 WP_000235792.1.8605 WP_000235792.1.86084 WP_000235792.1.8610 WP_000235792.1.8614 WP_000235792.1.86156 WP_000235792.1.86323 WP_000235792.1.86342 WP_000235792.1.8640 WP_000235792.1.8642 WP_000235792.1.86426 WP_000235792.1.86489 WP_000235792.1.86530 WP_000235792.1.86663 WP_000235792.1.86770 WP_000235792.1.86794 WP_000235792.1.86800 WP_000235792.1.86811 WP_000235792.1.86815 WP_000235792.1.86945 WP_000235792.1.86989 WP_000235792.1.87023 WP_000235792.1.87034 WP_000235792.1.87041 WP_000235792.1.87136 WP_000235792.1.87155 WP_000235792.1.87258 WP_000235792.1.87293 WP_000235792.1.87420 WP_000235792.1.87528 WP_000235792.1.87560 WP_000235792.1.8760 WP_000235792.1.87600 WP_000235792.1.87609 WP_000235792.1.87612 WP_000235792.1.87615 WP_000235792.1.87653 WP_000235792.1.87659 WP_000235792.1.87698 WP_000235792.1.87706 WP_000235792.1.87739 WP_000235792.1.87741 WP_000235792.1.87742 WP_000235792.1.87852 WP_000235792.1.87949 WP_000235792.1.88025 WP_000235792.1.8805 WP_000235792.1.8806 WP_000235792.1.881 WP_000235792.1.88145 WP_000235792.1.88199 WP_000235792.1.88299 WP_000235792.1.88313 WP_000235792.1.88359 WP_000235792.1.88407 WP_000235792.1.88414 WP_000235792.1.88444 WP_000235792.1.88446 WP_000235792.1.88458 WP_000235792.1.88501 WP_000235792.1.88538 WP_000235792.1.88547 WP_000235792.1.886 WP_000235792.1.88647 WP_000235792.1.88648 WP_000235792.1.88692 WP_000235792.1.88707 WP_000235792.1.88727 WP_000235792.1.88772 WP_000235792.1.88850 WP_000235792.1.8889 WP_000235792.1.88892 WP_000235792.1.88894 WP_000235792.1.89182 WP_000235792.1.89298 WP_000235792.1.89308 WP_000235792.1.89314 WP_000235792.1.89328 WP_000235792.1.89332 WP_000235792.1.89343 WP_000235792.1.89395 WP_000235792.1.8940 WP_000235792.1.89449 WP_000235792.1.8947 WP_000235792.1.89503 WP_000235792.1.89591 WP_000235792.1.89612 WP_000235792.1.89668 WP_000235792.1.89706 WP_000235792.1.89713 WP_000235792.1.89733 WP_000235792.1.89796 WP_000235792.1.89804 WP_000235792.1.89845 WP_000235792.1.89888 WP_000235792.1.89911 WP_000235792.1.8995 WP_000235792.1.89952 WP_000235792.1.9011 WP_000235792.1.90196 WP_000235792.1.90274 WP_000235792.1.90280 WP_000235792.1.90330 WP_000235792.1.90338 WP_000235792.1.90365 WP_000235792.1.90428 WP_000235792.1.90489 WP_000235792.1.90513 WP_000235792.1.90582 WP_000235792.1.90713 WP_000235792.1.90794 WP_000235792.1.90796 WP_000235792.1.90811 WP_000235792.1.9091 WP_000235792.1.91067 WP_000235792.1.91164 WP_000235792.1.91205 WP_000235792.1.91239 WP_000235792.1.91291 WP_000235792.1.91313 WP_000235792.1.9135 WP_000235792.1.91506 WP_000235792.1.91557 WP_000235792.1.91597 WP_000235792.1.91715 WP_000235792.1.9187 WP_000235792.1.91870 WP_000235792.1.92018 WP_000235792.1.92087 WP_000235792.1.92098 WP_000235792.1.92156 WP_000235792.1.92172 WP_000235792.1.92240 WP_000235792.1.92243 WP_000235792.1.92327 WP_000235792.1.92470 WP_000235792.1.92477 WP_000235792.1.92545 WP_000235792.1.92570 WP_000235792.1.92588 WP_000235792.1.926 WP_000235792.1.92633 WP_000235792.1.92649 WP_000235792.1.92676 WP_000235792.1.92705 WP_000235792.1.9271 WP_000235792.1.92734 WP_000235792.1.92810 WP_000235792.1.92823 WP_000235792.1.92987 WP_000235792.1.93007 WP_000235792.1.93022 WP_000235792.1.93105 WP_000235792.1.93111 WP_000235792.1.93121 WP_000235792.1.93168 WP_000235792.1.93184 WP_000235792.1.93221 WP_000235792.1.93223 WP_000235792.1.93239 WP_000235792.1.93302 WP_000235792.1.9336 WP_000235792.1.93387 WP_000235792.1.93469 WP_000235792.1.93511 WP_000235792.1.93512 WP_000235792.1.93635 WP_000235792.1.93657 WP_000235792.1.9374 WP_000235792.1.9375 WP_000235792.1.93754 WP_000235792.1.93780 WP_000235792.1.93828 WP_000235792.1.93842 WP_000235792.1.93843 WP_000235792.1.93875 WP_000235792.1.93909 WP_000235792.1.93919 WP_000235792.1.93938 WP_000235792.1.93984 WP_000235792.1.9399 WP_000235792.1.94017 WP_000235792.1.94079 WP_000235792.1.94107 WP_000235792.1.94142 WP_000235792.1.94215 WP_000235792.1.94303 WP_000235792.1.94365 WP_000235792.1.94390 WP_000235792.1.94415 WP_000235792.1.94510 WP_000235792.1.94527 WP_000235792.1.94573 WP_000235792.1.94579 WP_000235792.1.94586 WP_000235792.1.94593 WP_000235792.1.94650 WP_000235792.1.94659 WP_000235792.1.94662 WP_000235792.1.94700 WP_000235792.1.94745 WP_000235792.1.94782 WP_000235792.1.94815 WP_000235792.1.94820 WP_000235792.1.94850 WP_000235792.1.94851 WP_000235792.1.94864 WP_000235792.1.94952 WP_000235792.1.95006 WP_000235792.1.95055 WP_000235792.1.95076 WP_000235792.1.95099 WP_000235792.1.95165 WP_000235792.1.95239 WP_000235792.1.95246 WP_000235792.1.9525 WP_000235792.1.95255 WP_000235792.1.95265 WP_000235792.1.95338 WP_000235792.1.95412 WP_000235792.1.95530 WP_000235792.1.95547 WP_000235792.1.95590 WP_000235792.1.95625 WP_000235792.1.95675 WP_000235792.1.95716 WP_000235792.1.95776 WP_000235792.1.95884 WP_000235792.1.95890 WP_000235792.1.95906 WP_000235792.1.96025 WP_000235792.1.96044 WP_000235792.1.96054 WP_000235792.1.96094 WP_000235792.1.96127 WP_000235792.1.96144 WP_000235792.1.96188 WP_000235792.1.96211 WP_000235792.1.96212 WP_000235792.1.96319 WP_000235792.1.9633 WP_000235792.1.96359 WP_000235792.1.96539 WP_000235792.1.96552 WP_000235792.1.96610 WP_000235792.1.96625 WP_000235792.1.96635 WP_000235792.1.9664 WP_000235792.1.96675 WP_000235792.1.9670 WP_000235792.1.96750 WP_000235792.1.96792 WP_000235792.1.96801 WP_000235792.1.96803 WP_000235792.1.96925 WP_000235792.1.96938 WP_000235792.1.96946 WP_000235792.1.96957 WP_000235792.1.96978 WP_000235792.1.97026 WP_000235792.1.97028 WP_000235792.1.97079 WP_000235792.1.97154 WP_000235792.1.97184 WP_000235792.1.97287 WP_000235792.1.97291 WP_000235792.1.97422 WP_000235792.1.97441 WP_000235792.1.97497 WP_000235792.1.97505 WP_000235792.1.97599 WP_000235792.1.97606 WP_000235792.1.97615 WP_000235792.1.97646 WP_000235792.1.97690 WP_000235792.1.97819 WP_000235792.1.97840 WP_000235792.1.97938 WP_000235792.1.98036 WP_000235792.1.98080 WP_000235792.1.98086 WP_000235792.1.98158 WP_000235792.1.98263 WP_000235792.1.98418 WP_000235792.1.98448 WP_000235792.1.98457 WP_000235792.1.9850 WP_000235792.1.98607 WP_000235792.1.98731 WP_000235792.1.98762 WP_000235792.1.9877 WP_000235792.1.98801 WP_000235792.1.98818 WP_000235792.1.99163 WP_000235792.1.99335 WP_000235792.1.99350 WP_000235792.1.99360 WP_000235792.1.99363 WP_000235792.1.99369 WP_000235792.1.99388 WP_000235792.1.99397 WP_000235792.1.99463 WP_000235792.1.99483 WP_000235792.1.99546 WP_000235792.1.99579 WP_000235792.1.99595 WP_000235792.1.99671 WP_000235792.1.99676 WP_000235792.1.99764 WP_000235792.1.99829 WP_000235792.1.99837 WP_000235792.1.99841 WP_000235792.1.99996 gi|29140561|ref|NP_803903.1| 209261.t0018 220341.STY0018 gi|16759011|ref|NP_454628.1| AE014613|CDS_17873-19972 AL513382|CDS_17873-19972 gi|488652577|ref|YP_007924380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]