SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|57234390|ref|YP_181574.1| from Dehalococcoides ethenogenes 195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|57234390|ref|YP_181574.1|
Domain Number 1 Region: 28-91
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000115
Family NfeD domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|57234390|ref|YP_181574.1|
Sequence length 96
Comment hypothetical protein DET0847 [Dehalococcoides ethenogenes 195]
Sequence
MSWYWIVPLIIIAVLVIIFVVNQVVSAHLKQAATGKEELYGKKALVKTPLNPEGKVLYDG
EIWAAHIENGSAEVGQEVVIVRLEGLKLYVKMERSE
Download sequence
Identical sequences A0A223ZAV1 Q3Z875
WP_010936575.1.69666 243164.DET0847 gi|57234390|ref|YP_181574.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]