SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339499445|ref|YP_004697480.1| from Spirochaeta caldaria DSM 7334

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339499445|ref|YP_004697480.1|
Domain Number 1 Region: 15-294
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.68e-88
Family L-arabinose binding protein-like 0.000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339499445|ref|YP_004697480.1|
Sequence length 295
Comment periplasmic binding protein/LacI transcriptional regulator [Treponema caldaria DSM 7334]
Sequence
MKKLRTVTLVALAGAAILIGCGGTSAPSKKIGLAISTLNNPFFVTLKEGAEAKAKELGYE
LVVTDAQDDPAKQAGQIDDLIQKKVSIILLNPCNSDAAKTMVEKATKAKIPVISVDRGVN
GATVLSHIASDNVAGGVMAGEELLALVGEGAKVVELQGIPGASATVDRGTGFHQAVDGKL
NVVASQSADFNRDKGFTVMQNIIQANKDIKGVFAHNDEMALGAVQALEAVGMKTVVVIGF
DATDDAVAAVKAGRMKATVAQKPALIGSMAVDTAVKYLKGETVSAKIPVPLELVK
Download sequence
Identical sequences F8F0A8
WP_013968283.1.55161 gi|339499445|ref|YP_004697480.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]