SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|19074027|ref|NP_584633.1| from Encephalitozoon cuniculi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19074027|ref|NP_584633.1|
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.54e-35
Family Ubiquitin-related 0.0000221
Further Details:      
 
Domain Number 2 Region: 100-147
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0000238
Family Ribosomal protein S27a 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|19074027|ref|NP_584633.1|
Sequence length 152
Comment similarity to monoubiquitin/carboxy-extension protein fusion [Encephalitozoon cuniculi GB-M1]
Sequence
MQIFVKTLTGKTITLEVEPGDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGGAKKKKKDFSTPKKVKEPRKKRGLSWLDNFTVTDDKVKMNGVSC
EVCGTEVFCGKIQSGFKCGRCYRVYDKDIASH
Download sequence
Identical sequences M1K941 Q8SWB3
6035.ECU02_1080 gi|19074027|ref|NP_584633.1| NP_584633.1.88742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]