SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|19074561|ref|NP_586067.1| from Encephalitozoon cuniculi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|19074561|ref|NP_586067.1|
Domain Number 1 Region: 15-102
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000157
Family Ubiquitin-related 0.0053
Further Details:      
 
Domain Number 2 Region: 104-156
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.00000000000119
Family Ribosomal protein L40e 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|19074561|ref|NP_586067.1|
Sequence length 157
Comment UBIQUITIN/ L40 RIBOSOMAL PROTEIN FUSION [Encephalitozoon cuniculi GB-M1]
Sequence
MGFPCTFWAILRAVWIFTSGNFCPLRMQIGVRFCGKTSFVQAEPSQSVLSLKALVGRACG
LDSSVMVLQHNSRILEDSGTMAGYGMRTLDTITAYPKLLGGGGNMSDNDAAMAMKEKNDC
LICRRCYARSGKAAEKCRKCFSKDLRLKKPLKAMKKK
Download sequence
Identical sequences M1KKT5
6035.ECU07_1380 gi|19074561|ref|NP_586067.1| NP_586067.1.88742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]