SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85690917|ref|XP_965858.1| from Encephalitozoon cuniculi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85690917|ref|XP_965858.1|
Domain Number 1 Region: 105-200
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000248
Family Ubiquitin-related 0.067
Further Details:      
 
Domain Number 2 Region: 9-52
Classification Level Classification E-value
Superfamily UBA-like 0.0000124
Family UBA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85690917|ref|XP_965858.1|
Sequence length 203
Comment hypothetical protein ECU01_0230 [Encephalitozoon cuniculi GB-M1]
Sequence
MEGGNKTETSDEEVVKYLVQSGFTREEVQNAMKGTGSRDIDILVNFIISSSQNRAHGGVK
QAKKVNNNKASKEAMDLEKRRKEELMKEKLYREQLINQIKADMAEKLEKERLEDERLMST
NVEKSEDISDCKIKLWVGDGTSLILGFSKNDTIEDLFRRIEAKLNKKRFNLFKMNHVTPV
ERSTKKISEIPGLYPRGVLFIEE
Download sequence
Identical sequences M1K515 Q8SWQ5
XP_965858.1.88742 gi|85690917|ref|XP_965858.1| 6035.ECU01_0230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]