SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193212798|ref|YP_001998751.1| from Chlorobaculum parvum NCIB 8327

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|193212798|ref|YP_001998751.1|
Domain Number - Region: 33-96
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Further Details:      
 
Domain Number - Region: 104-165
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 
Domain Number - Region: 178-235
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0209
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|193212798|ref|YP_001998751.1|
Sequence length 243
Comment PASTA domain-containing protein [Chlorobaculum parvum NCIB 8327]
Sequence
MKKVLIVILLFFAAIVAIDKLLLPYYTEIGQQTVVPDVRNMTYAQASKALEKVGLKAMKS
YNVRYLPNVSPDQVIDQVPAPSSVVKPGRNVYLVLNRKDKPNYPMPDLSGRTEHEARQAL
ERIGMVISDVQTQAISEPDQDGRVLSQSVPPDVVLKSGSEVSFIVGKLEQEPTGTRRVIV
PDVLGMSVDQARGVLIRSGLSLGKVSYERSMLLVPDTVIGQKPSANEMVQYGQSVDMTVA
EAE
Download sequence
Identical sequences B3QNP8
gi|193212798|ref|YP_001998751.1| 517417.Cpar_1145 WP_012502384.1.59511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]