SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193213503|ref|YP_001999456.1| from Chlorobaculum parvum NCIB 8327

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193213503|ref|YP_001999456.1|
Domain Number 1 Region: 10-151
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.45e-23
Family Multidrug-binding domain of transcription activator BmrR 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193213503|ref|YP_001999456.1|
Sequence length 158
Comment transcription activator effector binding protein [Chlorobaculum parvum NCIB 8327]
Sequence
MDFECQFVCELKELAPVPAIVIRTRVAVSEIGPLFDSGFREIRQVLESQGKQPSAPSFAR
YYDMSEGSLDVEFGYPVDGNVQVSGRVVSASTPSGKAATCLYIGPYSEIEPAYSALMKWI
AENSLEMNGEAYEIYLDDPFETPPEKLRTQIHLLLRED
Download sequence
Identical sequences B3QQQ3
gi|193213503|ref|YP_001999456.1| 517417.Cpar_1864 WP_012503089.1.59511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]