SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|193213703|ref|YP_001999656.1| from Chlorobaculum parvum NCIB 8327

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|193213703|ref|YP_001999656.1|
Domain Number 1 Region: 228-567
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.77e-92
Family beta-Lactamase/D-ala carboxypeptidase 0.0000601
Further Details:      
 
Domain Number 2 Region: 65-227
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 6.02e-35
Family Penicillin binding protein dimerisation domain 0.00092
Further Details:      
 
Domain Number 3 Region: 590-646
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000366
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|193213703|ref|YP_001999656.1|
Sequence length 652
Comment peptidoglycan glycosyltransferase [Chlorobaculum parvum NCIB 8327]
Sequence
MNEEQGIQQQHAAGSGDRDFGLRLGIIGVLMLVFFTAIVMQLLRIQVLDVGKYREKASRQ
YVRKIDEHGRRGSILDRHGRPLAESVETISFAADPSRIKDRSQVARLFSQNFGKSSYYYL
KKLKRKRRFVWMERNVPVTKAAGLMTAGLKGIDFRREQQRHYLNVAAQLIGLTDRDNLGV
SGLEKSFEKRLRGGEGSRVFYRSAIGELYPAPDVEQVPPLGGNSVELTIDADIQAIVEDE
IMRAVNEQQATAAMGIVMDVRSGEILAMANYPTFDMNSRKGVTFARMRNRAVTDMFEPGS
TFKLVMAAGATEVLHWKASHVVDGHEGLLMIHGKPVRDHEPLGLIPFRKAITESSNVVAA
STALQLGPENFYHYATALGFGKKTGVGLIGESSGLLKPVSDWGKLTLPWMGYGYQVMATP
LQVLQAYATLANDGARMRPYIVRRIIDPDGRVVMENEPKKVVQALEPESARYITREYFRP
VVEEGTGQSAAIEGVAVAGKTGTAQKFYNGSYHGWSHYLSSFVGYFPAENPQYAAIIVVD
EPKTAYYASAVAAPVFSRVCGRALACSPEMQRRLELKSPERSRLDGIATVAVPVLQGLSG
NEASKLLEWHGLSMGRTGDDDGYVTSQSVAPGTKVRKESRVTVHLERKKKEK
Download sequence
Identical sequences B3QLX0
WP_012503289.1.59511 gi|193213703|ref|YP_001999656.1| 517417.Cpar_2070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]