SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433605428|ref|YP_007037797.1| from Saccharothrix espanaensis DSM 44229

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433605428|ref|YP_007037797.1|
Domain Number 1 Region: 117-353,390-524
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.32e-40
Family AAT-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|433605428|ref|YP_007037797.1|
Sequence length 544
Comment Aspartate 4-decarboxylase [Saccharothrix espanaensis DSM 44229]
Sequence
MPKSSVTRAEMRELAGLSPFELKGEFIRLAEHHHDDQRARSALLMLNAGRGNPNWIATGP
REAFYALGHFSLTESRRVWTADNLGGMPAKAGIADRFAAFVKAHPDLPGIDLLERSVRLG
TERFGFDPDSWVHELTDGITADNYPTPDRMLALTEQVARAYLHQELFDGRPADTGLKLFA
TEGGTAAMCYIFDSLIANGVLRKGDRIALMVPIFTPYIEIPDLDEYQFDVELVHADLFVE
QGVRQWRYPTEEVAKLADPSIRLVCLVNPSNPPSLALSDRVRDQISGIIANDNPDLIVVT
DDVYGTFVNGFRTIAADLPRNSLLVYSYSKHYGATGWRLGLIGLHDDNVIDDLITRLPEE
EQDRLRARYGTLSLRPDKIPFIDRLVADSRRVALNHTAGLSLPQQVQLGLFSLFAMQDEG
KAYKARVQEIVRTRLELLVEGAGMKIADDPQRAGYYLELDLLAEAERVYGAEFARHLEAT
YEPIDPLFRLAEHASVVLLNGGGFDGPKWSVRVSLANLDDLDYLKIGHHLHTVFAEYHDE
WTSA
Download sequence
Identical sequences K0K224
gi|433605428|ref|YP_007037797.1| WP_015101036.1.58275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]