SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319789894|ref|YP_004151527.1| from Thermovibrio ammonificans HB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319789894|ref|YP_004151527.1|
Domain Number 1 Region: 1-284
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.84e-62
Family Methylenetetrahydrofolate reductase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319789894|ref|YP_004151527.1|
Sequence length 293
Comment methylenetetrahydrofolate reductase [Thermovibrio ammonificans HB-1]
Sequence
MSFRQKLEAGKFVITAEVAPPRGTVFSLEALEPLKGKVDAFNVTDCQRSMVRMSPLVAAK
LLLDAGFEPVLQLTCRDRNRIALQADLLGAWALGLENLCLMTGDFTTLGDQPDAKPVFDL
DSVQLIELASSLNGGKLLNGKEIDHPTDFFIGAVFNPFAGPERLQLFKLEKKVKAGARFI
QTQPVYSLEVAQRACSQIREAGAVPIVGLLPVKSLKMASFIEKLNPGSVPPSLLEGLERS
RDPARYGWEFILELAEAVTEFAGGVHFMLTGRPDQLARFIDYLRNSSPYNHRF
Download sequence
Identical sequences E8T1Z1
gi|319789894|ref|YP_004151527.1| WP_013537672.1.42620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]