SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319790176|ref|YP_004151809.1| from Thermovibrio ammonificans HB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319790176|ref|YP_004151809.1|
Domain Number 1 Region: 205-398
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.66e-71
Family B3/B4 domain of PheRS, PheT 0.00000441
Further Details:      
 
Domain Number 2 Region: 41-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.23e-44
Family Myf domain 0.0029
Further Details:      
 
Domain Number 3 Region: 471-688
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.24e-44
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000429
Further Details:      
 
Domain Number 4 Region: 697-793
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.83e-29
Family Anticodon-binding domain of PheRS 0.00016
Further Details:      
 
Domain Number 5 Region: 406-478
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000339
Family Domains B1 and B5 of PheRS-beta, PheT 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319790176|ref|YP_004151809.1|
Sequence length 794
Comment phenylalanyl-tRNA synthetase, beta subunit [Thermovibrio ammonificans HB-1]
Sequence
MKITYNWLKEFIEIDDLSAKEVADLLTDAGIEVDAVYNPAEEVEKVVIGRITEISKHPNA
DRLRICQVDVGDTVLQIVTGADNVYEGAVVPVALHGAKLPGGVRIKRAKLRGVVSNGMLC
SAVELGLTDSAPGVWTLPEELGEKVGEDAVTALGLNDWVIEYEITTNRPDALSVLGIARE
LRAMLGRPVKLPETGYSCGEFNAEEEATLKVLDQGACPRYEGFVVKGISNRESPLWMQVR
LYLVGLRPINAVVDVTNYVMYELGQPLHAFDLEKLSGREVVVRRAREGEKIVTLDGVERE
LSGEDLVIADAEKPVAVAGVMGGLESGTTLSTRELFLESAHFDPMTVRRTSKRLGLSTDS
SYRFERGADIEACKFAAERALHLIQKLVGGEVAKGSLSFYPKPYTPKVIVFSPERAVKLL
GVNIPARKAFEILTGLGFTVKKEADYIVVKVPSWRKYDVTREVDLIEEVVRIYGMKRVVS
SFPLMHSEVPRDFTFLRVQEVKEFLSSLGFNEAINYSFIGKKLFEKFGLPVDRLVKIKNP
LSEEWVYMRNFLFPSLVNNAVNNINRNERDVFLFEVARTFSPTEEELPKEELKVALLATG
ELPENLWQFREVDFYDIKGAVEALGEFLGLELQFERREFPFLHPGQSGAVKLNGKEVGFL
GRLHPDVEERFEVRQPIFVAELNLEELLKQSAARTVKFKPIPKFPPVTRDIAVVVDRSTP
VAEIEKVIRESARYLEKLKLFDVYEGKGIPEGKKSVAFSLTFRAKEKTLSDEEVNKIMAD
IIEALQRSGATLRA
Download sequence
Identical sequences E8T2V9
gi|319790176|ref|YP_004151809.1| WP_013537954.1.42620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]