SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319790338|ref|YP_004151971.1| from Thermovibrio ammonificans HB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319790338|ref|YP_004151971.1|
Domain Number 1 Region: 9-223
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.82e-58
Family PP-loop ATPase 0.000046
Further Details:      
 
Domain Number 2 Region: 328-416
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000000628
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0076
Further Details:      
 
Domain Number 3 Region: 209-308
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000314
Family MesJ substrate recognition domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319790338|ref|YP_004151971.1|
Sequence length 443
Comment tRNA(Ile)-lysidine synthetase [Thermovibrio ammonificans HB-1]
Sequence
MFKEKVLSTCQKFNLIPPGSKLLVALSGGPDSVALLNVLLELRGELQLSSLAAVHVNHQL
RGAESERDERFVKELCGQLGVPLFTERVTVNPKGKGVEAAARQERYRVFDRVLRLWKGDY
VALGHTASDLAETVLLNLAKGTGIRGLRGFLPKRDRYVRPLFEVTRREVEEYLELKGLPY
IVDSSNLSTDFERNLIRIEVVPRLRRLNPRFEESVLRLTSTLRGIEFFLNSQVEALLERF
TAGGHFCAPLEELLKLPEVLQGELLIGAVKRLTGKGLSFRKVEKCLELIKKGSFARYSLG
NGLTFVVDAGRACILPEQEGLKPFEFRVTDLPAEIETPSGVLRFSLNRGYPLIPLKKFKG
QGIIVRNRKPGDRVDLGRHTRPLKKLLNEAKVPVLERDGLPVVEFGGRVLYVPFVSLPRR
ELPQPFVGVEFEERKSSDSPAGD
Download sequence
Identical sequences E8T3S3
WP_013538116.1.42620 gi|319790338|ref|YP_004151971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]