SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319790548|ref|YP_004152181.1| from Thermovibrio ammonificans HB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319790548|ref|YP_004152181.1|
Domain Number 1 Region: 6-228
Classification Level Classification E-value
Superfamily Ribosomal protein L1 6.67e-83
Family Ribosomal protein L1 0.000000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|319790548|ref|YP_004152181.1|
Sequence length 240
Comment 50S ribosomal protein L1 [Thermovibrio ammonificans HB-1]
Sequence
MPKHGKKYMNALALVDRKKLYPLKEAIALVKKMADVTQRNFDQTVEMAVRLNVDPKYQDQ
MVRGSVVLPHGLGKERVVAVIAQGEKLNEAKEAGADYVGGDDLIQKIQQGWLDFDVLIAT
PDMMGKVGRLGRILGPRGLMPNPKTGTVTFDVAKAVKEAKRGKVDFKVEKAGIVHAPIGK
VSFDEEKLYENAVALMKAILAAKPSGAKGQYVKSVAVAATMDPGVKVDVFDAVNAAQSVE
Download sequence
Identical sequences E8T508
WP_013538326.1.42620 gi|319790548|ref|YP_004152181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]