SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85373540|ref|YP_457602.1| from Erythrobacter litoralis HTCC2594

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85373540|ref|YP_457602.1|
Domain Number 1 Region: 23-115
Classification Level Classification E-value
Superfamily YccV-like 3.92e-35
Family YccV-like 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|85373540|ref|YP_457602.1|
Sequence length 126
Comment hypothetical protein ELI_03565 [Erythrobacter litoralis HTCC2594]
Sequence
MDSATFFSPQAGRQIEAPLRLNARFGIGDVVRHRMFDFRGVIFDIDPVFANSEEWYESIP
QEIRPRRDQPYYHLFAENEDSSYVAYVSQQNLVADSENGAVEHPQVPELFGEFDGKRYRM
RRSLTH
Download sequence
Identical sequences Q2NBY6
WP_011413681.1.18910 314225.ELI_03565 gi|85373540|ref|YP_457602.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]