SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85374722|ref|YP_458784.1| from Erythrobacter litoralis HTCC2594

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85374722|ref|YP_458784.1|
Domain Number 1 Region: 77-438
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.11e-90
Family Cystathionine synthase-like 0.000000914
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85374722|ref|YP_458784.1|
Sequence length 439
Comment methionine gamma-lyase [Erythrobacter litoralis HTCC2594]
Sequence
MTDAVDATDQPTPRRNPKPKATTINGREMKPSTLMMGHGFDPALSEGSLKSPIFLTSTFA
FENAAAGKRHFERITGQRPGGADGLVYSRFNAPNQEILEDRLAIWDGAEEALSFSSGMTA
IAILMLAACKAGDVIVHSGPLYAASEGFVAKTMAKFGVTYVDFPAGASRKELDEVMQKAK
AQAEAQGGEVPLIYLESPGNPTNALVDVEAVRDARDAHFDADRCPIAIDNTFLGPLWQRP
LEHGADLVVYSLTKYVGGHSDLVAGSVAGKKRFIDAIRALRNTMGGIADPNTAWMLCRSL
ETVELRMQRAGENAEKVCAFLAQHPKVEGLGYLGMIKDDRQKDIYDRHCLGAGSTFSLFL
KGGEAECFRFLDALKVAKLAVSLGGTETLASHPASMTHLSVAHGRRQELGITDSLVRISI
GIEDADDLIADFEQALEAV
Download sequence
Identical sequences Q2N8K4
WP_011414815.1.18910 314225.ELI_09475 gi|85374722|ref|YP_458784.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]