SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187730203|ref|YP_001882500.1| from Shigella boydii CDC 3083-94

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187730203|ref|YP_001882500.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.19e-40
Family Frataxin-like 0.000000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187730203|ref|YP_001882500.1|
Sequence length 106
Comment frataxin-like protein [Shigella boydii CDC 3083-94]
Sequence
MNDSEFHRLADQLWLTIEEHLDDWDGDSDIDCEINGGVLTITFENGSKIIINRQEPLHQV
WLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAATQQAGETVSFR
Download sequence
Identical sequences A0A029HEQ5 A0A029IHK8 A0A0D7H4A3 A0A0E2KYY1 A0A0H3ER06 A0A1E3MZI5 A0A1S9K8G7 A0A1X3K2C9 A0A2D0P2A8 A0A2K0Q3C7 A1AHX3 B2TUW2 B7MH68 B7N297 B7UNC2 E3XW12 E7SHD0 E7TCS1 F4T654 H4IIL6 H4IZJ7 H4JFM5 H4KPF9 H4LJN2 I6CD14 I6DJL4 I6FIB0 K0WQW4 Q0TAR9 Q1R4D1 Q31UI1 R8WKU2 S0TUA8 S0WY79 V0V008
gi|82546159|ref|YP_410105.1| gi|218560870|ref|YP_002393783.1| gi|386606384|ref|YP_006112684.1| 300268.SBO_3819 344609.SbBS512_E4266 362663.ECP_4000 364106.UTI89_C4366 405955.APECO1_2671 574521.E2348C_4105 585035.ECS88_4230 585397.ECED1_4492 gi|387831698|ref|YP_003351635.1| gi|222158500|ref|YP_002558639.1| WP_000999936.1.100116 WP_000999936.1.100220 WP_000999936.1.100447 WP_000999936.1.100735 WP_000999936.1.100738 WP_000999936.1.100898 WP_000999936.1.100950 WP_000999936.1.101052 WP_000999936.1.101152 WP_000999936.1.101429 WP_000999936.1.101586 WP_000999936.1.101694 WP_000999936.1.10181 WP_000999936.1.101926 WP_000999936.1.102144 WP_000999936.1.10326 WP_000999936.1.10492 WP_000999936.1.10697 WP_000999936.1.10787 WP_000999936.1.11057 WP_000999936.1.11113 WP_000999936.1.11217 WP_000999936.1.11250 WP_000999936.1.11296 WP_000999936.1.11399 WP_000999936.1.11519 WP_000999936.1.11531 WP_000999936.1.11608 WP_000999936.1.12009 WP_000999936.1.12010 WP_000999936.1.12076 WP_000999936.1.12088 WP_000999936.1.12111 WP_000999936.1.12157 WP_000999936.1.12709 WP_000999936.1.12761 WP_000999936.1.12763 WP_000999936.1.12830 WP_000999936.1.12915 WP_000999936.1.13144 WP_000999936.1.13181 WP_000999936.1.1323 WP_000999936.1.1343 WP_000999936.1.13798 WP_000999936.1.13867 WP_000999936.1.14023 WP_000999936.1.14129 WP_000999936.1.14144 WP_000999936.1.14164 WP_000999936.1.14253 WP_000999936.1.14331 WP_000999936.1.14445 WP_000999936.1.14509 WP_000999936.1.14538 WP_000999936.1.14605 WP_000999936.1.14712 WP_000999936.1.14807 WP_000999936.1.14935 WP_000999936.1.15020 WP_000999936.1.15274 WP_000999936.1.15304 WP_000999936.1.15768 WP_000999936.1.15857 WP_000999936.1.15869 WP_000999936.1.15984 WP_000999936.1.16131 WP_000999936.1.16175 WP_000999936.1.16608 WP_000999936.1.16862 WP_000999936.1.16927 WP_000999936.1.17461 WP_000999936.1.17584 WP_000999936.1.17734 WP_000999936.1.1802 WP_000999936.1.1821 WP_000999936.1.18225 WP_000999936.1.18337 WP_000999936.1.18420 WP_000999936.1.18802 WP_000999936.1.18828 WP_000999936.1.18934 WP_000999936.1.1896 WP_000999936.1.18962 WP_000999936.1.19129 WP_000999936.1.19135 WP_000999936.1.19146 WP_000999936.1.19245 WP_000999936.1.19379 WP_000999936.1.19465 WP_000999936.1.19651 WP_000999936.1.19654 WP_000999936.1.19760 WP_000999936.1.1987 WP_000999936.1.20115 WP_000999936.1.2015 WP_000999936.1.20224 WP_000999936.1.2027 WP_000999936.1.20289 WP_000999936.1.20452 WP_000999936.1.20575 WP_000999936.1.20640 WP_000999936.1.20709 WP_000999936.1.20761 WP_000999936.1.20803 WP_000999936.1.20818 WP_000999936.1.2089 WP_000999936.1.20907 WP_000999936.1.2092 WP_000999936.1.20933 WP_000999936.1.21024 WP_000999936.1.21634 WP_000999936.1.21714 WP_000999936.1.21729 WP_000999936.1.21773 WP_000999936.1.21899 WP_000999936.1.22042 WP_000999936.1.22182 WP_000999936.1.22189 WP_000999936.1.2245 WP_000999936.1.22508 WP_000999936.1.22543 WP_000999936.1.22549 WP_000999936.1.22757 WP_000999936.1.22939 WP_000999936.1.23021 WP_000999936.1.23042 WP_000999936.1.2322 WP_000999936.1.23230 WP_000999936.1.2325 WP_000999936.1.23386 WP_000999936.1.23435 WP_000999936.1.23575 WP_000999936.1.23686 WP_000999936.1.23711 WP_000999936.1.23962 WP_000999936.1.24004 WP_000999936.1.24038 WP_000999936.1.24169 WP_000999936.1.24524 WP_000999936.1.24909 WP_000999936.1.2502 WP_000999936.1.25021 WP_000999936.1.25079 WP_000999936.1.2512 WP_000999936.1.25174 WP_000999936.1.25270 WP_000999936.1.25372 WP_000999936.1.2540 WP_000999936.1.25680 WP_000999936.1.25712 WP_000999936.1.26040 WP_000999936.1.2606 WP_000999936.1.26092 WP_000999936.1.26125 WP_000999936.1.26131 WP_000999936.1.26259 WP_000999936.1.26574 WP_000999936.1.26627 WP_000999936.1.26659 WP_000999936.1.26660 WP_000999936.1.26688 WP_000999936.1.26782 WP_000999936.1.26861 WP_000999936.1.2688 WP_000999936.1.26932 WP_000999936.1.27426 WP_000999936.1.2745 WP_000999936.1.27520 WP_000999936.1.27618 WP_000999936.1.2779 WP_000999936.1.27861 WP_000999936.1.27932 WP_000999936.1.2794 WP_000999936.1.28008 WP_000999936.1.28027 WP_000999936.1.28046 WP_000999936.1.28051 WP_000999936.1.28199 WP_000999936.1.2838 WP_000999936.1.285 WP_000999936.1.28500 WP_000999936.1.28536 WP_000999936.1.2866 WP_000999936.1.28732 WP_000999936.1.28736 WP_000999936.1.28842 WP_000999936.1.29230 WP_000999936.1.29341 WP_000999936.1.29377 WP_000999936.1.29513 WP_000999936.1.29523 WP_000999936.1.29662 WP_000999936.1.29820 WP_000999936.1.29979 WP_000999936.1.30269 WP_000999936.1.30298 WP_000999936.1.30447 WP_000999936.1.30536 WP_000999936.1.3055 WP_000999936.1.30550 WP_000999936.1.30570 WP_000999936.1.30658 WP_000999936.1.30691 WP_000999936.1.3083 WP_000999936.1.30896 WP_000999936.1.30905 WP_000999936.1.31119 WP_000999936.1.31129 WP_000999936.1.31559 WP_000999936.1.31596 WP_000999936.1.31657 WP_000999936.1.31823 WP_000999936.1.31825 WP_000999936.1.31863 WP_000999936.1.32024 WP_000999936.1.32094 WP_000999936.1.32225 WP_000999936.1.32587 WP_000999936.1.33190 WP_000999936.1.33217 WP_000999936.1.33563 WP_000999936.1.33584 WP_000999936.1.33905 WP_000999936.1.34117 WP_000999936.1.34130 WP_000999936.1.34303 WP_000999936.1.3432 WP_000999936.1.34422 WP_000999936.1.34528 WP_000999936.1.34683 WP_000999936.1.34835 WP_000999936.1.34913 WP_000999936.1.35039 WP_000999936.1.35253 WP_000999936.1.35258 WP_000999936.1.35328 WP_000999936.1.35483 WP_000999936.1.3598 WP_000999936.1.3600 WP_000999936.1.36132 WP_000999936.1.36158 WP_000999936.1.3624 WP_000999936.1.36414 WP_000999936.1.365 WP_000999936.1.36545 WP_000999936.1.36799 WP_000999936.1.37103 WP_000999936.1.37226 WP_000999936.1.37266 WP_000999936.1.37312 WP_000999936.1.37313 WP_000999936.1.37388 WP_000999936.1.37592 WP_000999936.1.37664 WP_000999936.1.37736 WP_000999936.1.37853 WP_000999936.1.37962 WP_000999936.1.37967 WP_000999936.1.37984 WP_000999936.1.38194 WP_000999936.1.38293 WP_000999936.1.39209 WP_000999936.1.39325 WP_000999936.1.39327 WP_000999936.1.39377 WP_000999936.1.39423 WP_000999936.1.39717 WP_000999936.1.39726 WP_000999936.1.40190 WP_000999936.1.40211 WP_000999936.1.40539 WP_000999936.1.40607 WP_000999936.1.41113 WP_000999936.1.4122 WP_000999936.1.41271 WP_000999936.1.41822 WP_000999936.1.41847 WP_000999936.1.41884 WP_000999936.1.4189 WP_000999936.1.41923 WP_000999936.1.42191 WP_000999936.1.42228 WP_000999936.1.42258 WP_000999936.1.42350 WP_000999936.1.42413 WP_000999936.1.42586 WP_000999936.1.42597 WP_000999936.1.42670 WP_000999936.1.42804 WP_000999936.1.42903 WP_000999936.1.42970 WP_000999936.1.42991 WP_000999936.1.43027 WP_000999936.1.43170 WP_000999936.1.43422 WP_000999936.1.4356 WP_000999936.1.43733 WP_000999936.1.43803 WP_000999936.1.43868 WP_000999936.1.43953 WP_000999936.1.440 WP_000999936.1.44251 WP_000999936.1.44452 WP_000999936.1.44460 WP_000999936.1.44622 WP_000999936.1.44800 WP_000999936.1.44840 WP_000999936.1.44843 WP_000999936.1.4530 WP_000999936.1.4541 WP_000999936.1.45536 WP_000999936.1.45538 WP_000999936.1.45793 WP_000999936.1.45801 WP_000999936.1.45921 WP_000999936.1.45990 WP_000999936.1.46016 WP_000999936.1.4610 WP_000999936.1.46263 WP_000999936.1.46378 WP_000999936.1.46643 WP_000999936.1.46798 WP_000999936.1.46833 WP_000999936.1.4695 WP_000999936.1.47024 WP_000999936.1.47039 WP_000999936.1.47054 WP_000999936.1.47198 WP_000999936.1.4743 WP_000999936.1.47709 WP_000999936.1.48121 WP_000999936.1.48265 WP_000999936.1.48620 WP_000999936.1.48629 WP_000999936.1.48808 WP_000999936.1.49001 WP_000999936.1.49061 WP_000999936.1.49104 WP_000999936.1.49338 WP_000999936.1.49446 WP_000999936.1.49522 WP_000999936.1.49662 WP_000999936.1.49675 WP_000999936.1.49794 WP_000999936.1.49820 WP_000999936.1.4985 WP_000999936.1.49941 WP_000999936.1.50056 WP_000999936.1.50214 WP_000999936.1.50270 WP_000999936.1.50608 WP_000999936.1.50627 WP_000999936.1.50700 WP_000999936.1.50887 WP_000999936.1.511 WP_000999936.1.51203 WP_000999936.1.51307 WP_000999936.1.51757 WP_000999936.1.518 WP_000999936.1.51804 WP_000999936.1.51896 WP_000999936.1.51944 WP_000999936.1.5199 WP_000999936.1.52299 WP_000999936.1.52363 WP_000999936.1.52704 WP_000999936.1.5285 WP_000999936.1.53123 WP_000999936.1.53162 WP_000999936.1.53410 WP_000999936.1.53415 WP_000999936.1.53557 WP_000999936.1.53587 WP_000999936.1.53649 WP_000999936.1.53690 WP_000999936.1.53940 WP_000999936.1.54051 WP_000999936.1.54102 WP_000999936.1.54313 WP_000999936.1.54388 WP_000999936.1.54394 WP_000999936.1.54417 WP_000999936.1.54524 WP_000999936.1.54585 WP_000999936.1.54875 WP_000999936.1.54940 WP_000999936.1.55179 WP_000999936.1.55185 WP_000999936.1.55273 WP_000999936.1.55420 WP_000999936.1.55550 WP_000999936.1.55744 WP_000999936.1.55870 WP_000999936.1.55888 WP_000999936.1.55896 WP_000999936.1.56047 WP_000999936.1.56469 WP_000999936.1.56523 WP_000999936.1.56650 WP_000999936.1.56714 WP_000999936.1.57011 WP_000999936.1.57045 WP_000999936.1.57079 WP_000999936.1.57213 WP_000999936.1.57278 WP_000999936.1.57349 WP_000999936.1.57539 WP_000999936.1.57814 WP_000999936.1.57851 WP_000999936.1.57854 WP_000999936.1.5787 WP_000999936.1.58009 WP_000999936.1.58038 WP_000999936.1.58107 WP_000999936.1.58292 WP_000999936.1.58414 WP_000999936.1.58424 WP_000999936.1.58449 WP_000999936.1.58459 WP_000999936.1.58657 WP_000999936.1.58737 WP_000999936.1.5927 WP_000999936.1.59291 WP_000999936.1.59425 WP_000999936.1.59579 WP_000999936.1.59613 WP_000999936.1.59714 WP_000999936.1.59793 WP_000999936.1.59894 WP_000999936.1.59900 WP_000999936.1.59981 WP_000999936.1.60096 WP_000999936.1.60350 WP_000999936.1.60453 WP_000999936.1.60591 WP_000999936.1.60630 WP_000999936.1.60654 WP_000999936.1.61121 WP_000999936.1.613 WP_000999936.1.6138 WP_000999936.1.61442 WP_000999936.1.61617 WP_000999936.1.61739 WP_000999936.1.61789 WP_000999936.1.61835 WP_000999936.1.62038 WP_000999936.1.62043 WP_000999936.1.62236 WP_000999936.1.62266 WP_000999936.1.62282 WP_000999936.1.62780 WP_000999936.1.62784 WP_000999936.1.62819 WP_000999936.1.6282 WP_000999936.1.62866 WP_000999936.1.62885 WP_000999936.1.62951 WP_000999936.1.63271 WP_000999936.1.63285 WP_000999936.1.63305 WP_000999936.1.63433 WP_000999936.1.63814 WP_000999936.1.64030 WP_000999936.1.64190 WP_000999936.1.64312 WP_000999936.1.6444 WP_000999936.1.64670 WP_000999936.1.64784 WP_000999936.1.64840 WP_000999936.1.64875 WP_000999936.1.65056 WP_000999936.1.65116 WP_000999936.1.65240 WP_000999936.1.65355 WP_000999936.1.65405 WP_000999936.1.65565 WP_000999936.1.65571 WP_000999936.1.6576 WP_000999936.1.65834 WP_000999936.1.66071 WP_000999936.1.66255 WP_000999936.1.66295 WP_000999936.1.66392 WP_000999936.1.66421 WP_000999936.1.66523 WP_000999936.1.66668 WP_000999936.1.66708 WP_000999936.1.66787 WP_000999936.1.66984 WP_000999936.1.67047 WP_000999936.1.67055 WP_000999936.1.67132 WP_000999936.1.67278 WP_000999936.1.67284 WP_000999936.1.67373 WP_000999936.1.67495 WP_000999936.1.67690 WP_000999936.1.67760 WP_000999936.1.67891 WP_000999936.1.67894 WP_000999936.1.68058 WP_000999936.1.68059 WP_000999936.1.68063 WP_000999936.1.68067 WP_000999936.1.68157 WP_000999936.1.68231 WP_000999936.1.68271 WP_000999936.1.68292 WP_000999936.1.68372 WP_000999936.1.68441 WP_000999936.1.6859 WP_000999936.1.68632 WP_000999936.1.68731 WP_000999936.1.68735 WP_000999936.1.68838 WP_000999936.1.68877 WP_000999936.1.68911 WP_000999936.1.6892 WP_000999936.1.68942 WP_000999936.1.68952 WP_000999936.1.69158 WP_000999936.1.69327 WP_000999936.1.69438 WP_000999936.1.69502 WP_000999936.1.69506 WP_000999936.1.69735 WP_000999936.1.69831 WP_000999936.1.69999 WP_000999936.1.70299 WP_000999936.1.70300 WP_000999936.1.70337 WP_000999936.1.70386 WP_000999936.1.70408 WP_000999936.1.70563 WP_000999936.1.70655 WP_000999936.1.71149 WP_000999936.1.7121 WP_000999936.1.71538 WP_000999936.1.71562 WP_000999936.1.71607 WP_000999936.1.71830 WP_000999936.1.71972 WP_000999936.1.72048 WP_000999936.1.72098 WP_000999936.1.72258 WP_000999936.1.72298 WP_000999936.1.72436 WP_000999936.1.72469 WP_000999936.1.72551 WP_000999936.1.72588 WP_000999936.1.72596 WP_000999936.1.72706 WP_000999936.1.72950 WP_000999936.1.72962 WP_000999936.1.7309 WP_000999936.1.73333 WP_000999936.1.73572 WP_000999936.1.73748 WP_000999936.1.73783 WP_000999936.1.7407 WP_000999936.1.74185 WP_000999936.1.74358 WP_000999936.1.744 WP_000999936.1.74426 WP_000999936.1.74611 WP_000999936.1.74623 WP_000999936.1.74682 WP_000999936.1.74767 WP_000999936.1.75087 WP_000999936.1.75100 WP_000999936.1.75808 WP_000999936.1.75892 WP_000999936.1.76057 WP_000999936.1.76194 WP_000999936.1.76335 WP_000999936.1.76469 WP_000999936.1.76596 WP_000999936.1.76643 WP_000999936.1.76759 WP_000999936.1.76863 WP_000999936.1.76994 WP_000999936.1.77007 WP_000999936.1.77057 WP_000999936.1.77081 WP_000999936.1.77204 WP_000999936.1.7729 WP_000999936.1.77320 WP_000999936.1.77408 WP_000999936.1.77432 WP_000999936.1.7747 WP_000999936.1.77481 WP_000999936.1.7750 WP_000999936.1.77511 WP_000999936.1.7756 WP_000999936.1.78183 WP_000999936.1.78187 WP_000999936.1.78323 WP_000999936.1.78376 WP_000999936.1.78463 WP_000999936.1.78572 WP_000999936.1.78622 WP_000999936.1.78677 WP_000999936.1.78714 WP_000999936.1.78773 WP_000999936.1.78893 WP_000999936.1.78895 WP_000999936.1.79348 WP_000999936.1.79365 WP_000999936.1.79368 WP_000999936.1.79464 WP_000999936.1.7967 WP_000999936.1.79707 WP_000999936.1.79749 WP_000999936.1.79922 WP_000999936.1.79955 WP_000999936.1.80168 WP_000999936.1.804 WP_000999936.1.80558 WP_000999936.1.80559 WP_000999936.1.81186 WP_000999936.1.81347 WP_000999936.1.81396 WP_000999936.1.81418 WP_000999936.1.82008 WP_000999936.1.82166 WP_000999936.1.82527 WP_000999936.1.82539 WP_000999936.1.82589 WP_000999936.1.83125 WP_000999936.1.83127 WP_000999936.1.83218 WP_000999936.1.83313 WP_000999936.1.83375 WP_000999936.1.83393 WP_000999936.1.83506 WP_000999936.1.83582 WP_000999936.1.83668 WP_000999936.1.83911 WP_000999936.1.83936 WP_000999936.1.84014 WP_000999936.1.84059 WP_000999936.1.8408 WP_000999936.1.84197 WP_000999936.1.84326 WP_000999936.1.85048 WP_000999936.1.85125 WP_000999936.1.8530 WP_000999936.1.85315 WP_000999936.1.85504 WP_000999936.1.85556 WP_000999936.1.85781 WP_000999936.1.86104 WP_000999936.1.86179 WP_000999936.1.86196 WP_000999936.1.86586 WP_000999936.1.86627 WP_000999936.1.86717 WP_000999936.1.8705 WP_000999936.1.87067 WP_000999936.1.87074 WP_000999936.1.87102 WP_000999936.1.87205 WP_000999936.1.87443 WP_000999936.1.87504 WP_000999936.1.87581 WP_000999936.1.87590 WP_000999936.1.87633 WP_000999936.1.87675 WP_000999936.1.87738 WP_000999936.1.87883 WP_000999936.1.87990 WP_000999936.1.88147 WP_000999936.1.88234 WP_000999936.1.88260 WP_000999936.1.88527 WP_000999936.1.88557 WP_000999936.1.88562 WP_000999936.1.88941 WP_000999936.1.89150 WP_000999936.1.89217 WP_000999936.1.89312 WP_000999936.1.89334 WP_000999936.1.89351 WP_000999936.1.89379 WP_000999936.1.89427 WP_000999936.1.89631 WP_000999936.1.89747 WP_000999936.1.90171 WP_000999936.1.9037 WP_000999936.1.90542 WP_000999936.1.90602 WP_000999936.1.90844 WP_000999936.1.9119 WP_000999936.1.91220 WP_000999936.1.91482 WP_000999936.1.91515 WP_000999936.1.91666 WP_000999936.1.91814 WP_000999936.1.91843 WP_000999936.1.9185 WP_000999936.1.91887 WP_000999936.1.92025 WP_000999936.1.92053 WP_000999936.1.92201 WP_000999936.1.92276 WP_000999936.1.92403 WP_000999936.1.92648 WP_000999936.1.93150 WP_000999936.1.93291 WP_000999936.1.93326 WP_000999936.1.934 WP_000999936.1.93533 WP_000999936.1.93679 WP_000999936.1.93694 WP_000999936.1.93870 WP_000999936.1.94069 WP_000999936.1.9420 WP_000999936.1.94282 WP_000999936.1.94446 WP_000999936.1.94619 WP_000999936.1.94686 WP_000999936.1.94704 WP_000999936.1.95310 WP_000999936.1.95449 WP_000999936.1.95858 WP_000999936.1.96097 WP_000999936.1.96143 WP_000999936.1.96253 WP_000999936.1.96392 WP_000999936.1.9641 WP_000999936.1.96478 WP_000999936.1.9649 WP_000999936.1.96633 WP_000999936.1.96676 WP_000999936.1.96759 WP_000999936.1.96797 WP_000999936.1.96907 WP_000999936.1.97282 WP_000999936.1.97387 WP_000999936.1.97437 WP_000999936.1.97502 WP_000999936.1.97525 WP_000999936.1.97549 WP_000999936.1.97654 WP_000999936.1.97778 WP_000999936.1.98102 WP_000999936.1.98251 WP_000999936.1.98480 WP_000999936.1.98484 WP_000999936.1.98727 WP_000999936.1.98757 WP_000999936.1.98775 WP_000999936.1.99006 WP_000999936.1.9930 WP_000999936.1.99306 WP_000999936.1.99401 WP_000999936.1.99472 WP_000999936.1.9950 WP_000999936.1.99549 WP_000999936.1.99771 WP_000999936.1.99782 WP_000999936.1.99874 YP_006122121.1.29421 gi|386601831|ref|YP_006103337.1| gi|387619099|ref|YP_006122121.1| gi|91213328|ref|YP_543314.1| gi|110644131|ref|YP_671861.1| gi|544578347|ref|YP_008573871.1| gi|187730203|ref|YP_001882500.1| gi|117626064|ref|YP_859387.1| gi|218692083|ref|YP_002400295.1| gi|215489133|ref|YP_002331564.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]