SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187731232|ref|YP_001881839.1| from Shigella boydii CDC 3083-94

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187731232|ref|YP_001881839.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.79e-110
Family FMN-linked oxidoreductases 0.0000000000101
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.06e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000032
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.67e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187731232|ref|YP_001881839.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Shigella boydii CDC 3083-94]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLHTNQR
SDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYHRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIARFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences B2U1T1
344609.SbBS512_E3517 gi|187731232|ref|YP_001881839.1| WP_000121439.1.14129 WP_000121439.1.19129 WP_000121439.1.28536 WP_000121439.1.3598 WP_000121439.1.37967 WP_000121439.1.49104 WP_000121439.1.51307 WP_000121439.1.57851 WP_000121439.1.60453 WP_000121439.1.62266 WP_000121439.1.71149 WP_000121439.1.79464 WP_000121439.1.79922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]