SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187733213|ref|YP_001880835.1| from Shigella boydii CDC 3083-94

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187733213|ref|YP_001880835.1|
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily YccV-like 7.03e-30
Family YccV-like 0.00000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187733213|ref|YP_001880835.1|
Sequence length 105
Comment heat shock protein HspQ [Shigella boydii CDC 3083-94]
Sequence
MIASKFGIGQQVRHSLLGYLGVVVDIDPVYSLSEPSPDELAVNDELRAAPWYHVVMEDDN
GLPVHTYLAEAQLSSELQDEHPEQPSMDELAQTIRKQLQAPRLRN
Download sequence
Identical sequences A0A023YUQ6 A0A024KUR2 A0A025CNF0 A0A026UI51 A0A027U7K6 A0A028AET2 A0A028E7I5 A0A029I6G9 A0A029IX75 A0A062YFB0 A0A064TMP4 A0A069XQW4 A0A070F400 A0A070T3V1 A0A070V1N3 A0A073GB78 A0A073HNN8 A0A073UGF0 A0A074I893 A0A080G2C2 A0A080J2D8 A0A0A8UBP6 A0A0E0TX95 A0A0E0V304 A0A0E0Y1K1 A0A0E1M019 A0A0E1SST5 A0A0E2L8F8 A0A0E2TSN8 A0A0F6C1G3 A0A0F6F3M8 A0A0G3K3F8 A0A0H3EH94 A0A0H3PXE0 A0A0H7VQA4 A0A0K9TEM2 A0A0M7PDC3 A0A0S3NII2 A0A125X593 A0A127GM66 A0A140NDD3 A0A142H1I8 A0A163V2V4 A0A1E2VIY7 A0A1E3N1D2 A0A1Q8MIY4 A0A1Q8N8P7 A0A1S6T931 A0A1W2MHC8 A0A1X3IQP7 A0A1X3JUG1 A0A1X3LHN0 A0A1X3LVY9 A0A1X3MC59 A0A1Z3USC8 A0A222QIK4 A0A226KAV6 A0A2D0NPI2 A0A2H1BDC4 A0A2I8C313 A1A9N5 A7ZK70 B1EPH8 B1IVW6 B1LJ31 B1X8S0 B2TTS8 B3WZH5 B5YT97 B6I941 B7LE66 B7M895 B7MIC0 B7MS77 B7N3C9 B7NLF0 B7UN45 C4ZQ92 C8U5D0 C8ULI8 D3H0I9 D6HV17 D6I8N5 D6J8T3 E0IZ76 E2QJH0 E3XUU8 E7SJN0 E7T7Y7 E9XMZ6 E9YSI6 F3V4F2 F3WGV2 F5N4P5 F5NSV2 G0F6M1 H4I930 H4IPG8 H4J5X3 H4KEL3 H4LA30 H4UGM1 I0VP88 I2RB03 I2S617 I2SZ97 I2UKH8 I2WCX7 I2WVD0 I2XCI2 I4SAW2 I6BYA5 I6D082 I6DCH9 I6E171 I6FR85 I6H6Y5 K0X8P2 K4W7S3 K4WET2 L2V6T3 L2W0B9 L2XRL5 L3BR38 L3P9M6 L3QBI2 L3QNW1 L4JCJ5 L4VX72 M9GB27 P0AB20 P0AB21 P0AB22 P0AB23 Q0T668 Q0TJ94 Q1RDP6 Q31YM9 Q3Z3F4 R8Z3Z0 S0TNF1 S0WD34 S0WLZ2 S0Y2P1 S0Z8S6 S1CWI5 S1DYH5 S1ERK8 S1FEI8 S1HQA3 S1ICY6 S1IQS8 S1MEQ1 S1Q6I6 T5VCF4 T6ACM1 T6IA82 T6MDH3 T8JIM0 T9AEU6 T9EFN8 T9TC14 V2R1C7 V2TNR8 V6FZ01 V8FE31 W0ANW3 W1ALS0 W1F5I9 W1X1B7
gi|388477050|ref|YP_489238.1| gi|218694441|ref|YP_002402108.1| gi|38703906|ref|NP_309077.2| gi|251784508|ref|YP_002998812.1| gi|386598738|ref|YP_006100244.1| gi|386605130|ref|YP_006111430.1| gi|251784508|ref|YP_002998812.1| gi|157156189|ref|YP_001462199.1| gi|222155685|ref|YP_002555824.1| gi|407482827|ref|YP_006779976.1| gi|387828933|ref|YP_003348870.1| 316385.ECDH10B_1036 316407.yccV 331111.EcE24377A_1081 331112.EcHS_A1075 344609.SbBS512_E2349 386585.ECs1050 409438.ECSE_1028 413997.ECB_00970 439855.EcSMS35_2152 444450.ECH74115_1131 469008.ECBD_2628 481805.EcolC_2630 511145.b0966 544404.ECSP_1072 573235.ECO26_1093 574521.E2348C_0952 585034.ECIAI1_1007 585035.ECS88_0988 585055.EC55989_1015 585056.ECUMN_1156 585057.ECIAI39_2179 585395.ECO103_1012 585396.ECO111_1034 585397.ECED1_0989 595496.BWG_0818 gi|253774004|ref|YP_003036835.1| gi|387616218|ref|YP_006119240.1| gi|544389725|ref|YP_008564134.1| gi|254161080|ref|YP_003044188.1| gi|170679789|ref|YP_001744202.1| gi|410483379|ref|YP_006770925.1| gi|386708778|ref|YP_006172499.1| gi|387881577|ref|YP_006311879.1| gi|145698238|ref|NP_415486.4| gi|443617083|ref|YP_007380939.1| gi|387606511|ref|YP_006095367.1| gi|387620693|ref|YP_006128320.1| gi|218704390|ref|YP_002411909.1| gi|215486084|ref|YP_002328515.1| gi|378713628|ref|YP_005278521.1| gi|386613241|ref|YP_006132907.1| gi|387506077|ref|YP_006158333.1| gi|218688802|ref|YP_002397014.1| 1vbvA 5ycq_A gi|378713628|ref|YP_005278521.1| gi|209918219|ref|YP_002292303.1| NP_309077.2.58667 NP_415486.4.90541 WP_001295356.1.1000 WP_001295356.1.10001 WP_001295356.1.100014 WP_001295356.1.100044 WP_001295356.1.100052 WP_001295356.1.100063 WP_001295356.1.100066 WP_001295356.1.100073 WP_001295356.1.100085 WP_001295356.1.10010 WP_001295356.1.100111 WP_001295356.1.100116 WP_001295356.1.100135 WP_001295356.1.100138 WP_001295356.1.100151 WP_001295356.1.100159 WP_001295356.1.100185 WP_001295356.1.100194 WP_001295356.1.100220 WP_001295356.1.100227 WP_001295356.1.100251 WP_001295356.1.100252 WP_001295356.1.100281 WP_001295356.1.100283 WP_001295356.1.100285 WP_001295356.1.100299 WP_001295356.1.100302 WP_001295356.1.100304 WP_001295356.1.100306 WP_001295356.1.100315 WP_001295356.1.10034 WP_001295356.1.100346 WP_001295356.1.100389 WP_001295356.1.100425 WP_001295356.1.100441 WP_001295356.1.100444 WP_001295356.1.100447 WP_001295356.1.100448 WP_001295356.1.100451 WP_001295356.1.100474 WP_001295356.1.10048 WP_001295356.1.100487 WP_001295356.1.100496 WP_001295356.1.100499 WP_001295356.1.100508 WP_001295356.1.10051 WP_001295356.1.100531 WP_001295356.1.100543 WP_001295356.1.100554 WP_001295356.1.100571 WP_001295356.1.100573 WP_001295356.1.100614 WP_001295356.1.100667 WP_001295356.1.10067 WP_001295356.1.10068 WP_001295356.1.100685 WP_001295356.1.100688 WP_001295356.1.100689 WP_001295356.1.100718 WP_001295356.1.100725 WP_001295356.1.100735 WP_001295356.1.100738 WP_001295356.1.100752 WP_001295356.1.100753 WP_001295356.1.100758 WP_001295356.1.100778 WP_001295356.1.100796 WP_001295356.1.10080 WP_001295356.1.100803 WP_001295356.1.100824 WP_001295356.1.100836 WP_001295356.1.100851 WP_001295356.1.100852 WP_001295356.1.10086 WP_001295356.1.100867 WP_001295356.1.100868 WP_001295356.1.100898 WP_001295356.1.100916 WP_001295356.1.100925 WP_001295356.1.100933 WP_001295356.1.10094 WP_001295356.1.100950 WP_001295356.1.100959 WP_001295356.1.100966 WP_001295356.1.100990 WP_001295356.1.10100 WP_001295356.1.101033 WP_001295356.1.101052 WP_001295356.1.101087 WP_001295356.1.101096 WP_001295356.1.1011 WP_001295356.1.101102 WP_001295356.1.101105 WP_001295356.1.101110 WP_001295356.1.101121 WP_001295356.1.101148 WP_001295356.1.101152 WP_001295356.1.101157 WP_001295356.1.101158 WP_001295356.1.101166 WP_001295356.1.101175 WP_001295356.1.101186 WP_001295356.1.101206 WP_001295356.1.101214 WP_001295356.1.101216 WP_001295356.1.101257 WP_001295356.1.10126 WP_001295356.1.101282 WP_001295356.1.101289 WP_001295356.1.101293 WP_001295356.1.10131 WP_001295356.1.101313 WP_001295356.1.101359 WP_001295356.1.10138 WP_001295356.1.101387 WP_001295356.1.101399 WP_001295356.1.101418 WP_001295356.1.101423 WP_001295356.1.101429 WP_001295356.1.101430 WP_001295356.1.101436 WP_001295356.1.101439 WP_001295356.1.101445 WP_001295356.1.101468 WP_001295356.1.101486 WP_001295356.1.101518 WP_001295356.1.101522 WP_001295356.1.10154 WP_001295356.1.101545 WP_001295356.1.101583 WP_001295356.1.101586 WP_001295356.1.101594 WP_001295356.1.101628 WP_001295356.1.101630 WP_001295356.1.101651 WP_001295356.1.101653 WP_001295356.1.101654 WP_001295356.1.101667 WP_001295356.1.101668 WP_001295356.1.101686 WP_001295356.1.101693 WP_001295356.1.101694 WP_001295356.1.101700 WP_001295356.1.101727 WP_001295356.1.10173 WP_001295356.1.101737 WP_001295356.1.101747 WP_001295356.1.101769 WP_001295356.1.101777 WP_001295356.1.101786 WP_001295356.1.10181 WP_001295356.1.101822 WP_001295356.1.10184 WP_001295356.1.101840 WP_001295356.1.101845 WP_001295356.1.101855 WP_001295356.1.101865 WP_001295356.1.10187 WP_001295356.1.10188 WP_001295356.1.101887 WP_001295356.1.101889 WP_001295356.1.10190 WP_001295356.1.101900 WP_001295356.1.101908 WP_001295356.1.101913 WP_001295356.1.101926 WP_001295356.1.101932 WP_001295356.1.101935 WP_001295356.1.101937 WP_001295356.1.101940 WP_001295356.1.101942 WP_001295356.1.101947 WP_001295356.1.101948 WP_001295356.1.101952 WP_001295356.1.101962 WP_001295356.1.101964 WP_001295356.1.101969 WP_001295356.1.101977 WP_001295356.1.101984 WP_001295356.1.101987 WP_001295356.1.102021 WP_001295356.1.102036 WP_001295356.1.10206 WP_001295356.1.102069 WP_001295356.1.102076 WP_001295356.1.102093 WP_001295356.1.102094 WP_001295356.1.102104 WP_001295356.1.102106 WP_001295356.1.102122 WP_001295356.1.102139 WP_001295356.1.102144 WP_001295356.1.10222 WP_001295356.1.10226 WP_001295356.1.10233 WP_001295356.1.10235 WP_001295356.1.10252 WP_001295356.1.10273 WP_001295356.1.10304 WP_001295356.1.10326 WP_001295356.1.10329 WP_001295356.1.10335 WP_001295356.1.10348 WP_001295356.1.10352 WP_001295356.1.10361 WP_001295356.1.10379 WP_001295356.1.10381 WP_001295356.1.1040 WP_001295356.1.10400 WP_001295356.1.10417 WP_001295356.1.10461 WP_001295356.1.10476 WP_001295356.1.10491 WP_001295356.1.10492 WP_001295356.1.10496 WP_001295356.1.10508 WP_001295356.1.10524 WP_001295356.1.10525 WP_001295356.1.10538 WP_001295356.1.10569 WP_001295356.1.10573 WP_001295356.1.10576 WP_001295356.1.10579 WP_001295356.1.1058 WP_001295356.1.10605 WP_001295356.1.10607 WP_001295356.1.10628 WP_001295356.1.10651 WP_001295356.1.10673 WP_001295356.1.10697 WP_001295356.1.10705 WP_001295356.1.1071 WP_001295356.1.10715 WP_001295356.1.10729 WP_001295356.1.1073 WP_001295356.1.1074 WP_001295356.1.10744 WP_001295356.1.10748 WP_001295356.1.10761 WP_001295356.1.10763 WP_001295356.1.10771 WP_001295356.1.10786 WP_001295356.1.10787 WP_001295356.1.10798 WP_001295356.1.10809 WP_001295356.1.10814 WP_001295356.1.10824 WP_001295356.1.10833 WP_001295356.1.10842 WP_001295356.1.10849 WP_001295356.1.10862 WP_001295356.1.10869 WP_001295356.1.10922 WP_001295356.1.10940 WP_001295356.1.10970 WP_001295356.1.10988 WP_001295356.1.10989 WP_001295356.1.10994 WP_001295356.1.10995 WP_001295356.1.11006 WP_001295356.1.11032 WP_001295356.1.11047 WP_001295356.1.11052 WP_001295356.1.11057 WP_001295356.1.11068 WP_001295356.1.11071 WP_001295356.1.11091 WP_001295356.1.1111 WP_001295356.1.11113 WP_001295356.1.11118 WP_001295356.1.11121 WP_001295356.1.1113 WP_001295356.1.11133 WP_001295356.1.11217 WP_001295356.1.1122 WP_001295356.1.11240 WP_001295356.1.11241 WP_001295356.1.11250 WP_001295356.1.11251 WP_001295356.1.11265 WP_001295356.1.11272 WP_001295356.1.11285 WP_001295356.1.11296 WP_001295356.1.11301 WP_001295356.1.11315 WP_001295356.1.11323 WP_001295356.1.11399 WP_001295356.1.11408 WP_001295356.1.1141 WP_001295356.1.11411 WP_001295356.1.11418 WP_001295356.1.11420 WP_001295356.1.11436 WP_001295356.1.11437 WP_001295356.1.11440 WP_001295356.1.11452 WP_001295356.1.11467 WP_001295356.1.11499 WP_001295356.1.11519 WP_001295356.1.11524 WP_001295356.1.11531 WP_001295356.1.11542 WP_001295356.1.11575 WP_001295356.1.11578 WP_001295356.1.11595 WP_001295356.1.11607 WP_001295356.1.11608 WP_001295356.1.11612 WP_001295356.1.11616 WP_001295356.1.11671 WP_001295356.1.11673 WP_001295356.1.1168 WP_001295356.1.11690 WP_001295356.1.11699 WP_001295356.1.11748 WP_001295356.1.11759 WP_001295356.1.1176 WP_001295356.1.11762 WP_001295356.1.11801 WP_001295356.1.11803 WP_001295356.1.11844 WP_001295356.1.1186 WP_001295356.1.11912 WP_001295356.1.11948 WP_001295356.1.11949 WP_001295356.1.11955 WP_001295356.1.11956 WP_001295356.1.11981 WP_001295356.1.11982 WP_001295356.1.11985 WP_001295356.1.12000 WP_001295356.1.12009 WP_001295356.1.12010 WP_001295356.1.12030 WP_001295356.1.12036 WP_001295356.1.12050 WP_001295356.1.12051 WP_001295356.1.12060 WP_001295356.1.12076 WP_001295356.1.12088 WP_001295356.1.12095 WP_001295356.1.12111 WP_001295356.1.12112 WP_001295356.1.12115 WP_001295356.1.1212 WP_001295356.1.12151 WP_001295356.1.12157 WP_001295356.1.12174 WP_001295356.1.1218 WP_001295356.1.12204 WP_001295356.1.12230 WP_001295356.1.12259 WP_001295356.1.12268 WP_001295356.1.12279 WP_001295356.1.12292 WP_001295356.1.12295 WP_001295356.1.12305 WP_001295356.1.12319 WP_001295356.1.12320 WP_001295356.1.12342 WP_001295356.1.12344 WP_001295356.1.12352 WP_001295356.1.12415 WP_001295356.1.1242 WP_001295356.1.12426 WP_001295356.1.12458 WP_001295356.1.12459 WP_001295356.1.12468 WP_001295356.1.12478 WP_001295356.1.12542 WP_001295356.1.12552 WP_001295356.1.12558 WP_001295356.1.12566 WP_001295356.1.12574 WP_001295356.1.12582 WP_001295356.1.12594 WP_001295356.1.12645 WP_001295356.1.12646 WP_001295356.1.12675 WP_001295356.1.12679 WP_001295356.1.12680 WP_001295356.1.12693 WP_001295356.1.12697 WP_001295356.1.127 WP_001295356.1.12709 WP_001295356.1.12717 WP_001295356.1.12743 WP_001295356.1.12749 WP_001295356.1.1275 WP_001295356.1.12756 WP_001295356.1.12761 WP_001295356.1.12762 WP_001295356.1.12763 WP_001295356.1.12766 WP_001295356.1.12775 WP_001295356.1.1278 WP_001295356.1.12781 WP_001295356.1.1280 WP_001295356.1.12826 WP_001295356.1.12830 WP_001295356.1.12831 WP_001295356.1.12876 WP_001295356.1.12893 WP_001295356.1.12911 WP_001295356.1.12914 WP_001295356.1.12915 WP_001295356.1.12917 WP_001295356.1.12944 WP_001295356.1.1295 WP_001295356.1.12956 WP_001295356.1.12965 WP_001295356.1.12976 WP_001295356.1.12987 WP_001295356.1.12991 WP_001295356.1.13002 WP_001295356.1.13015 WP_001295356.1.13031 WP_001295356.1.13060 WP_001295356.1.13074 WP_001295356.1.1308 WP_001295356.1.13117 WP_001295356.1.1312 WP_001295356.1.13136 WP_001295356.1.1314 WP_001295356.1.13144 WP_001295356.1.1315 WP_001295356.1.13157 WP_001295356.1.13162 WP_001295356.1.13176 WP_001295356.1.13181 WP_001295356.1.13205 WP_001295356.1.13217 WP_001295356.1.13222 WP_001295356.1.13223 WP_001295356.1.1323 WP_001295356.1.13239 WP_001295356.1.13252 WP_001295356.1.13258 WP_001295356.1.13271 WP_001295356.1.13272 WP_001295356.1.13278 WP_001295356.1.13281 WP_001295356.1.13290 WP_001295356.1.13295 WP_001295356.1.13301 WP_001295356.1.13332 WP_001295356.1.13333 WP_001295356.1.13346 WP_001295356.1.13348 WP_001295356.1.1335 WP_001295356.1.13383 WP_001295356.1.13393 WP_001295356.1.13409 WP_001295356.1.13411 WP_001295356.1.1343 WP_001295356.1.13430 WP_001295356.1.13437 WP_001295356.1.13442 WP_001295356.1.1345 WP_001295356.1.13451 WP_001295356.1.13469 WP_001295356.1.13473 WP_001295356.1.13481 WP_001295356.1.13495 WP_001295356.1.13525 WP_001295356.1.13566 WP_001295356.1.13585 WP_001295356.1.13589 WP_001295356.1.13600 WP_001295356.1.13601 WP_001295356.1.13608 WP_001295356.1.13618 WP_001295356.1.13624 WP_001295356.1.13626 WP_001295356.1.13656 WP_001295356.1.13662 WP_001295356.1.13664 WP_001295356.1.13672 WP_001295356.1.13740 WP_001295356.1.13778 WP_001295356.1.13791 WP_001295356.1.13798 WP_001295356.1.13824 WP_001295356.1.13867 WP_001295356.1.13877 WP_001295356.1.13881 WP_001295356.1.13891 WP_001295356.1.13924 WP_001295356.1.13934 WP_001295356.1.13936 WP_001295356.1.13939 WP_001295356.1.13944 WP_001295356.1.13949 WP_001295356.1.13974 WP_001295356.1.13979 WP_001295356.1.14030 WP_001295356.1.14042 WP_001295356.1.14058 WP_001295356.1.14062 WP_001295356.1.14070 WP_001295356.1.14094 WP_001295356.1.14110 WP_001295356.1.14127 WP_001295356.1.14129 WP_001295356.1.14144 WP_001295356.1.14154 WP_001295356.1.14164 WP_001295356.1.1419 WP_001295356.1.14199 WP_001295356.1.142 WP_001295356.1.14245 WP_001295356.1.14253 WP_001295356.1.14277 WP_001295356.1.14292 WP_001295356.1.14299 WP_001295356.1.14304 WP_001295356.1.14322 WP_001295356.1.14331 WP_001295356.1.14346 WP_001295356.1.14371 WP_001295356.1.1438 WP_001295356.1.14389 WP_001295356.1.14398 WP_001295356.1.14417 WP_001295356.1.14432 WP_001295356.1.14445 WP_001295356.1.14451 WP_001295356.1.14453 WP_001295356.1.14468 WP_001295356.1.14493 WP_001295356.1.14499 WP_001295356.1.14501 WP_001295356.1.14506 WP_001295356.1.14508 WP_001295356.1.14509 WP_001295356.1.14536 WP_001295356.1.14538 WP_001295356.1.14581 WP_001295356.1.14582 WP_001295356.1.14600 WP_001295356.1.14601 WP_001295356.1.14605 WP_001295356.1.14607 WP_001295356.1.1461 WP_001295356.1.14616 WP_001295356.1.14621 WP_001295356.1.14648 WP_001295356.1.14661 WP_001295356.1.14672 WP_001295356.1.14678 WP_001295356.1.14687 WP_001295356.1.14693 WP_001295356.1.1470 WP_001295356.1.14711 WP_001295356.1.14712 WP_001295356.1.14746 WP_001295356.1.14748 WP_001295356.1.14749 WP_001295356.1.14807 WP_001295356.1.14811 WP_001295356.1.14833 WP_001295356.1.1486 WP_001295356.1.14861 WP_001295356.1.14871 WP_001295356.1.14879 WP_001295356.1.14914 WP_001295356.1.14934 WP_001295356.1.14935 WP_001295356.1.14946 WP_001295356.1.14956 WP_001295356.1.14958 WP_001295356.1.14963 WP_001295356.1.14965 WP_001295356.1.14977 WP_001295356.1.14992 WP_001295356.1.14993 WP_001295356.1.15007 WP_001295356.1.15020 WP_001295356.1.15041 WP_001295356.1.15068 WP_001295356.1.1508 WP_001295356.1.15087 WP_001295356.1.15090 WP_001295356.1.1510 WP_001295356.1.1512 WP_001295356.1.15121 WP_001295356.1.15138 WP_001295356.1.15148 WP_001295356.1.15177 WP_001295356.1.15191 WP_001295356.1.15193 WP_001295356.1.15207 WP_001295356.1.15221 WP_001295356.1.1524 WP_001295356.1.15245 WP_001295356.1.15252 WP_001295356.1.15259 WP_001295356.1.15270 WP_001295356.1.15274 WP_001295356.1.15277 WP_001295356.1.15282 WP_001295356.1.15287 WP_001295356.1.15290 WP_001295356.1.153 WP_001295356.1.15300 WP_001295356.1.15332 WP_001295356.1.15335 WP_001295356.1.15347 WP_001295356.1.15356 WP_001295356.1.15377 WP_001295356.1.15416 WP_001295356.1.15420 WP_001295356.1.1543 WP_001295356.1.15444 WP_001295356.1.15453 WP_001295356.1.15464 WP_001295356.1.15469 WP_001295356.1.15496 WP_001295356.1.1550 WP_001295356.1.15503 WP_001295356.1.15521 WP_001295356.1.15527 WP_001295356.1.15528 WP_001295356.1.15538 WP_001295356.1.15565 WP_001295356.1.15576 WP_001295356.1.15583 WP_001295356.1.1559 WP_001295356.1.15593 WP_001295356.1.15600 WP_001295356.1.1561 WP_001295356.1.15620 WP_001295356.1.15624 WP_001295356.1.15626 WP_001295356.1.15645 WP_001295356.1.15654 WP_001295356.1.15702 WP_001295356.1.15731 WP_001295356.1.15740 WP_001295356.1.15747 WP_001295356.1.15752 WP_001295356.1.15762 WP_001295356.1.15768 WP_001295356.1.15771 WP_001295356.1.15782 WP_001295356.1.15791 WP_001295356.1.1580 WP_001295356.1.15809 WP_001295356.1.1582 WP_001295356.1.15855 WP_001295356.1.15857 WP_001295356.1.15863 WP_001295356.1.15869 WP_001295356.1.1588 WP_001295356.1.15894 WP_001295356.1.15906 WP_001295356.1.15916 WP_001295356.1.15945 WP_001295356.1.15949 WP_001295356.1.15951 WP_001295356.1.15983 WP_001295356.1.15984 WP_001295356.1.15990 WP_001295356.1.16010 WP_001295356.1.16014 WP_001295356.1.16015 WP_001295356.1.16034 WP_001295356.1.1604 WP_001295356.1.16042 WP_001295356.1.16067 WP_001295356.1.16075 WP_001295356.1.16086 WP_001295356.1.16087 WP_001295356.1.1609 WP_001295356.1.16102 WP_001295356.1.16111 WP_001295356.1.16117 WP_001295356.1.16133 WP_001295356.1.16154 WP_001295356.1.16171 WP_001295356.1.16175 WP_001295356.1.16179 WP_001295356.1.16183 WP_001295356.1.16188 WP_001295356.1.16194 WP_001295356.1.1621 WP_001295356.1.1622 WP_001295356.1.16222 WP_001295356.1.16270 WP_001295356.1.16272 WP_001295356.1.16294 WP_001295356.1.163 WP_001295356.1.16303 WP_001295356.1.16322 WP_001295356.1.1634 WP_001295356.1.16387 WP_001295356.1.16388 WP_001295356.1.16396 WP_001295356.1.1640 WP_001295356.1.16435 WP_001295356.1.16463 WP_001295356.1.16481 WP_001295356.1.16482 WP_001295356.1.16500 WP_001295356.1.16517 WP_001295356.1.16532 WP_001295356.1.16539 WP_001295356.1.16541 WP_001295356.1.1655 WP_001295356.1.16577 WP_001295356.1.16604 WP_001295356.1.16608 WP_001295356.1.16612 WP_001295356.1.16640 WP_001295356.1.16648 WP_001295356.1.16667 WP_001295356.1.16669 WP_001295356.1.16682 WP_001295356.1.16685 WP_001295356.1.16700 WP_001295356.1.16705 WP_001295356.1.16715 WP_001295356.1.16721 WP_001295356.1.16745 WP_001295356.1.16752 WP_001295356.1.16766 WP_001295356.1.16780 WP_001295356.1.16798 WP_001295356.1.16799 WP_001295356.1.16805 WP_001295356.1.16807 WP_001295356.1.16818 WP_001295356.1.16843 WP_001295356.1.16845 WP_001295356.1.16861 WP_001295356.1.16862 WP_001295356.1.16894 WP_001295356.1.16927 WP_001295356.1.16970 WP_001295356.1.16979 WP_001295356.1.16992 WP_001295356.1.17014 WP_001295356.1.17017 WP_001295356.1.17018 WP_001295356.1.17028 WP_001295356.1.17042 WP_001295356.1.17061 WP_001295356.1.17084 WP_001295356.1.17085 WP_001295356.1.17087 WP_001295356.1.17089 WP_001295356.1.1710 WP_001295356.1.17101 WP_001295356.1.17102 WP_001295356.1.17109 WP_001295356.1.17111 WP_001295356.1.17114 WP_001295356.1.17119 WP_001295356.1.17123 WP_001295356.1.17150 WP_001295356.1.17153 WP_001295356.1.17170 WP_001295356.1.17172 WP_001295356.1.17182 WP_001295356.1.17186 WP_001295356.1.17187 WP_001295356.1.17205 WP_001295356.1.17206 WP_001295356.1.17216 WP_001295356.1.17230 WP_001295356.1.17241 WP_001295356.1.17242 WP_001295356.1.1726 WP_001295356.1.17267 WP_001295356.1.17282 WP_001295356.1.17290 WP_001295356.1.17297 WP_001295356.1.17300 WP_001295356.1.17301 WP_001295356.1.1731 WP_001295356.1.17325 WP_001295356.1.17333 WP_001295356.1.17356 WP_001295356.1.17360 WP_001295356.1.17373 WP_001295356.1.17386 WP_001295356.1.17387 WP_001295356.1.17389 WP_001295356.1.17392 WP_001295356.1.17403 WP_001295356.1.17415 WP_001295356.1.17417 WP_001295356.1.17432 WP_001295356.1.17441 WP_001295356.1.17461 WP_001295356.1.17464 WP_001295356.1.17496 WP_001295356.1.17515 WP_001295356.1.17534 WP_001295356.1.1754 WP_001295356.1.1755 WP_001295356.1.17550 WP_001295356.1.17568 WP_001295356.1.17570 WP_001295356.1.17577 WP_001295356.1.17584 WP_001295356.1.17595 WP_001295356.1.17623 WP_001295356.1.1763 WP_001295356.1.17637 WP_001295356.1.1766 WP_001295356.1.17680 WP_001295356.1.1769 WP_001295356.1.17701 WP_001295356.1.17711 WP_001295356.1.1772 WP_001295356.1.17734 WP_001295356.1.17757 WP_001295356.1.17765 WP_001295356.1.17766 WP_001295356.1.17769 WP_001295356.1.1778 WP_001295356.1.17802 WP_001295356.1.17829 WP_001295356.1.17831 WP_001295356.1.17836 WP_001295356.1.17849 WP_001295356.1.17889 WP_001295356.1.17904 WP_001295356.1.17920 WP_001295356.1.17925 WP_001295356.1.17937 WP_001295356.1.17952 WP_001295356.1.17961 WP_001295356.1.17963 WP_001295356.1.17984 WP_001295356.1.18000 WP_001295356.1.18006 WP_001295356.1.1802 WP_001295356.1.18024 WP_001295356.1.18050 WP_001295356.1.18064 WP_001295356.1.18094 WP_001295356.1.18112 WP_001295356.1.18118 WP_001295356.1.18121 WP_001295356.1.18133 WP_001295356.1.18134 WP_001295356.1.18136 WP_001295356.1.18141 WP_001295356.1.18164 WP_001295356.1.18175 WP_001295356.1.1821 WP_001295356.1.18225 WP_001295356.1.18226 WP_001295356.1.18229 WP_001295356.1.18275 WP_001295356.1.18311 WP_001295356.1.18316 WP_001295356.1.18326 WP_001295356.1.18329 WP_001295356.1.18337 WP_001295356.1.18338 WP_001295356.1.1834 WP_001295356.1.18340 WP_001295356.1.18348 WP_001295356.1.18354 WP_001295356.1.18381 WP_001295356.1.18383 WP_001295356.1.18394 WP_001295356.1.18402 WP_001295356.1.18410 WP_001295356.1.18420 WP_001295356.1.18428 WP_001295356.1.18436 WP_001295356.1.18438 WP_001295356.1.1844 WP_001295356.1.18458 WP_001295356.1.18461 WP_001295356.1.18472 WP_001295356.1.18482 WP_001295356.1.18511 WP_001295356.1.18519 WP_001295356.1.18530 WP_001295356.1.18550 WP_001295356.1.18556 WP_001295356.1.18581 WP_001295356.1.18583 WP_001295356.1.18588 WP_001295356.1.1861 WP_001295356.1.18617 WP_001295356.1.1862 WP_001295356.1.18649 WP_001295356.1.18650 WP_001295356.1.18651 WP_001295356.1.18655 WP_001295356.1.1866 WP_001295356.1.18666 WP_001295356.1.1867 WP_001295356.1.18675 WP_001295356.1.18699 WP_001295356.1.18725 WP_001295356.1.18726 WP_001295356.1.1873 WP_001295356.1.18734 WP_001295356.1.18794 WP_001295356.1.188 WP_001295356.1.18801 WP_001295356.1.18802 WP_001295356.1.18806 WP_001295356.1.1881 WP_001295356.1.18828 WP_001295356.1.18837 WP_001295356.1.18843 WP_001295356.1.18858 WP_001295356.1.18861 WP_001295356.1.18874 WP_001295356.1.18876 WP_001295356.1.18899 WP_001295356.1.18908 WP_001295356.1.18923 WP_001295356.1.18929 WP_001295356.1.18934 WP_001295356.1.18936 WP_001295356.1.1896 WP_001295356.1.18962 WP_001295356.1.18966 WP_001295356.1.18983 WP_001295356.1.18995 WP_001295356.1.19024 WP_001295356.1.1903 WP_001295356.1.19036 WP_001295356.1.19039 WP_001295356.1.1906 WP_001295356.1.19075 WP_001295356.1.1909 WP_001295356.1.19090 WP_001295356.1.191 WP_001295356.1.19100 WP_001295356.1.19113 WP_001295356.1.19114 WP_001295356.1.19122 WP_001295356.1.19129 WP_001295356.1.19135 WP_001295356.1.19140 WP_001295356.1.19146 WP_001295356.1.19147 WP_001295356.1.19148 WP_001295356.1.1915 WP_001295356.1.19150 WP_001295356.1.19153 WP_001295356.1.19171 WP_001295356.1.19194 WP_001295356.1.19205 WP_001295356.1.19206 WP_001295356.1.19245 WP_001295356.1.1925 WP_001295356.1.19276 WP_001295356.1.19277 WP_001295356.1.19297 WP_001295356.1.193 WP_001295356.1.19312 WP_001295356.1.19313 WP_001295356.1.19314 WP_001295356.1.19315 WP_001295356.1.19332 WP_001295356.1.19338 WP_001295356.1.19347 WP_001295356.1.19350 WP_001295356.1.19361 WP_001295356.1.19374 WP_001295356.1.19379 WP_001295356.1.19389 WP_001295356.1.19397 WP_001295356.1.19419 WP_001295356.1.19424 WP_001295356.1.19441 WP_001295356.1.19448 WP_001295356.1.19453 WP_001295356.1.19465 WP_001295356.1.19478 WP_001295356.1.19487 WP_001295356.1.19492 WP_001295356.1.19494 WP_001295356.1.1952 WP_001295356.1.19534 WP_001295356.1.19544 WP_001295356.1.19545 WP_001295356.1.19547 WP_001295356.1.19557 WP_001295356.1.19581 WP_001295356.1.19583 WP_001295356.1.19593 WP_001295356.1.1960 WP_001295356.1.19602 WP_001295356.1.1963 WP_001295356.1.19644 WP_001295356.1.19649 WP_001295356.1.19651 WP_001295356.1.19654 WP_001295356.1.19655 WP_001295356.1.19661 WP_001295356.1.19684 WP_001295356.1.19691 WP_001295356.1.19758 WP_001295356.1.19760 WP_001295356.1.19761 WP_001295356.1.19778 WP_001295356.1.19795 WP_001295356.1.1982 WP_001295356.1.19830 WP_001295356.1.19838 WP_001295356.1.19840 WP_001295356.1.19845 WP_001295356.1.19847 WP_001295356.1.19861 WP_001295356.1.1987 WP_001295356.1.19873 WP_001295356.1.19878 WP_001295356.1.19889 WP_001295356.1.19940 WP_001295356.1.19945 WP_001295356.1.19957 WP_001295356.1.19972 WP_001295356.1.19994 WP_001295356.1.20025 WP_001295356.1.2005 WP_001295356.1.20096 WP_001295356.1.20114 WP_001295356.1.20115 WP_001295356.1.20129 WP_001295356.1.20133 WP_001295356.1.20136 WP_001295356.1.2015 WP_001295356.1.20151 WP_001295356.1.20159 WP_001295356.1.20164 WP_001295356.1.20166 WP_001295356.1.20170 WP_001295356.1.20178 WP_001295356.1.20183 WP_001295356.1.20192 WP_001295356.1.2022 WP_001295356.1.20224 WP_001295356.1.20230 WP_001295356.1.20238 WP_001295356.1.20251 WP_001295356.1.20264 WP_001295356.1.2027 WP_001295356.1.20277 WP_001295356.1.20289 WP_001295356.1.20290 WP_001295356.1.20308 WP_001295356.1.20318 WP_001295356.1.20325 WP_001295356.1.20331 WP_001295356.1.20334 WP_001295356.1.20370 WP_001295356.1.20388 WP_001295356.1.20442 WP_001295356.1.20445 WP_001295356.1.20449 WP_001295356.1.20452 WP_001295356.1.20480 WP_001295356.1.20483 WP_001295356.1.20484 WP_001295356.1.20493 WP_001295356.1.20506 WP_001295356.1.20515 WP_001295356.1.20519 WP_001295356.1.20536 WP_001295356.1.20546 WP_001295356.1.20549 WP_001295356.1.20565 WP_001295356.1.20575 WP_001295356.1.20594 WP_001295356.1.20596 WP_001295356.1.20609 WP_001295356.1.2063 WP_001295356.1.20630 WP_001295356.1.20636 WP_001295356.1.20638 WP_001295356.1.20640 WP_001295356.1.20662 WP_001295356.1.20668 WP_001295356.1.20691 WP_001295356.1.20709 WP_001295356.1.20724 WP_001295356.1.20730 WP_001295356.1.20737 WP_001295356.1.20741 WP_001295356.1.20745 WP_001295356.1.2075 WP_001295356.1.20761 WP_001295356.1.20765 WP_001295356.1.20784 WP_001295356.1.20785 WP_001295356.1.20803 WP_001295356.1.20813 WP_001295356.1.20818 WP_001295356.1.20824 WP_001295356.1.20831 WP_001295356.1.20841 WP_001295356.1.20848 WP_001295356.1.20863 WP_001295356.1.2089 WP_001295356.1.20893 WP_001295356.1.20907 WP_001295356.1.2092 WP_001295356.1.2093 WP_001295356.1.2094 WP_001295356.1.20941 WP_001295356.1.20943 WP_001295356.1.20950 WP_001295356.1.20958 WP_001295356.1.20962 WP_001295356.1.20982 WP_001295356.1.20989 WP_001295356.1.2100 WP_001295356.1.21017 WP_001295356.1.21020 WP_001295356.1.21022 WP_001295356.1.21024 WP_001295356.1.21033 WP_001295356.1.21041 WP_001295356.1.21057 WP_001295356.1.21059 WP_001295356.1.21104 WP_001295356.1.21122 WP_001295356.1.21129 WP_001295356.1.2113 WP_001295356.1.21131 WP_001295356.1.21137 WP_001295356.1.21152 WP_001295356.1.21171 WP_001295356.1.21197 WP_001295356.1.21236 WP_001295356.1.21248 WP_001295356.1.21251 WP_001295356.1.21255 WP_001295356.1.21266 WP_001295356.1.21277 WP_001295356.1.21305 WP_001295356.1.21320 WP_001295356.1.21336 WP_001295356.1.21378 WP_001295356.1.2142 WP_001295356.1.21441 WP_001295356.1.21450 WP_001295356.1.21455 WP_001295356.1.21470 WP_001295356.1.21508 WP_001295356.1.21519 WP_001295356.1.21526 WP_001295356.1.2153 WP_001295356.1.21537 WP_001295356.1.2156 WP_001295356.1.21573 WP_001295356.1.21578 WP_001295356.1.21596 WP_001295356.1.21614 WP_001295356.1.21628 WP_001295356.1.21634 WP_001295356.1.21637 WP_001295356.1.2164 WP_001295356.1.21652 WP_001295356.1.21661 WP_001295356.1.21666 WP_001295356.1.21667 WP_001295356.1.21668 WP_001295356.1.21673 WP_001295356.1.21696 WP_001295356.1.21714 WP_001295356.1.21727 WP_001295356.1.21729 WP_001295356.1.21732 WP_001295356.1.21733 WP_001295356.1.21756 WP_001295356.1.21758 WP_001295356.1.21762 WP_001295356.1.21771 WP_001295356.1.21773 WP_001295356.1.21811 WP_001295356.1.21812 WP_001295356.1.21823 WP_001295356.1.21887 WP_001295356.1.21895 WP_001295356.1.21899 WP_001295356.1.21915 WP_001295356.1.21945 WP_001295356.1.21948 WP_001295356.1.21962 WP_001295356.1.2198 WP_001295356.1.21986 WP_001295356.1.21992 WP_001295356.1.22021 WP_001295356.1.22042 WP_001295356.1.22060 WP_001295356.1.22088 WP_001295356.1.22098 WP_001295356.1.22113 WP_001295356.1.22138 WP_001295356.1.22161 WP_001295356.1.2218 WP_001295356.1.22182 WP_001295356.1.22189 WP_001295356.1.22195 WP_001295356.1.22203 WP_001295356.1.22204 WP_001295356.1.22251 WP_001295356.1.22268 WP_001295356.1.22269 WP_001295356.1.22272 WP_001295356.1.22280 WP_001295356.1.22291 WP_001295356.1.22293 WP_001295356.1.22295 WP_001295356.1.22304 WP_001295356.1.22314 WP_001295356.1.2232 WP_001295356.1.22325 WP_001295356.1.22328 WP_001295356.1.22359 WP_001295356.1.22363 WP_001295356.1.22381 WP_001295356.1.22409 WP_001295356.1.2242 WP_001295356.1.22431 WP_001295356.1.2245 WP_001295356.1.22450 WP_001295356.1.22464 WP_001295356.1.22470 WP_001295356.1.22494 WP_001295356.1.22501 WP_001295356.1.22522 WP_001295356.1.22543 WP_001295356.1.22544 WP_001295356.1.22549 WP_001295356.1.22571 WP_001295356.1.22572 WP_001295356.1.22574 WP_001295356.1.22576 WP_001295356.1.22579 WP_001295356.1.22594 WP_001295356.1.22599 WP_001295356.1.22602 WP_001295356.1.22631 WP_001295356.1.22632 WP_001295356.1.22641 WP_001295356.1.22649 WP_001295356.1.22662 WP_001295356.1.22667 WP_001295356.1.22669 WP_001295356.1.22685 WP_001295356.1.22690 WP_001295356.1.22691 WP_001295356.1.22756 WP_001295356.1.22757 WP_001295356.1.22759 WP_001295356.1.22765 WP_001295356.1.22771 WP_001295356.1.22777 WP_001295356.1.22783 WP_001295356.1.22809 WP_001295356.1.22814 WP_001295356.1.22824 WP_001295356.1.22827 WP_001295356.1.22830 WP_001295356.1.22868 WP_001295356.1.22875 WP_001295356.1.22878 WP_001295356.1.22885 WP_001295356.1.22896 WP_001295356.1.22908 WP_001295356.1.22917 WP_001295356.1.22925 WP_001295356.1.22939 WP_001295356.1.22961 WP_001295356.1.22988 WP_001295356.1.22990 WP_001295356.1.22993 WP_001295356.1.2300 WP_001295356.1.23005 WP_001295356.1.23021 WP_001295356.1.23026 WP_001295356.1.23035 WP_001295356.1.23042 WP_001295356.1.23044 WP_001295356.1.23045 WP_001295356.1.23057 WP_001295356.1.23062 WP_001295356.1.23073 WP_001295356.1.23078 WP_001295356.1.23081 WP_001295356.1.23090 WP_001295356.1.23092 WP_001295356.1.23105 WP_001295356.1.23109 WP_001295356.1.23115 WP_001295356.1.23120 WP_001295356.1.23135 WP_001295356.1.2322 WP_001295356.1.23230 WP_001295356.1.23241 WP_001295356.1.2325 WP_001295356.1.23257 WP_001295356.1.23270 WP_001295356.1.23282 WP_001295356.1.23285 WP_001295356.1.23290 WP_001295356.1.23293 WP_001295356.1.23299 WP_001295356.1.23323 WP_001295356.1.23330 WP_001295356.1.23351 WP_001295356.1.23352 WP_001295356.1.23355 WP_001295356.1.23376 WP_001295356.1.23378 WP_001295356.1.23383 WP_001295356.1.23386 WP_001295356.1.23388 WP_001295356.1.23393 WP_001295356.1.23435 WP_001295356.1.23443 WP_001295356.1.23456 WP_001295356.1.23467 WP_001295356.1.23487 WP_001295356.1.23511 WP_001295356.1.23520 WP_001295356.1.23522 WP_001295356.1.23527 WP_001295356.1.2353 WP_001295356.1.23554 WP_001295356.1.23561 WP_001295356.1.23563 WP_001295356.1.23575 WP_001295356.1.23584 WP_001295356.1.23593 WP_001295356.1.2362 WP_001295356.1.23622 WP_001295356.1.23625 WP_001295356.1.23640 WP_001295356.1.23660 WP_001295356.1.23676 WP_001295356.1.23686 WP_001295356.1.23693 WP_001295356.1.23700 WP_001295356.1.23711 WP_001295356.1.23724 WP_001295356.1.23729 WP_001295356.1.23741 WP_001295356.1.23752 WP_001295356.1.23754 WP_001295356.1.23765 WP_001295356.1.23790 WP_001295356.1.23795 WP_001295356.1.23804 WP_001295356.1.23806 WP_001295356.1.23812 WP_001295356.1.23838 WP_001295356.1.23840 WP_001295356.1.23855 WP_001295356.1.23869 WP_001295356.1.2388 WP_001295356.1.23881 WP_001295356.1.23886 WP_001295356.1.23890 WP_001295356.1.23895 WP_001295356.1.23898 WP_001295356.1.23899 WP_001295356.1.23914 WP_001295356.1.23915 WP_001295356.1.23931 WP_001295356.1.23945 WP_001295356.1.2395 WP_001295356.1.23950 WP_001295356.1.23953 WP_001295356.1.23960 WP_001295356.1.23962 WP_001295356.1.23970 WP_001295356.1.23971 WP_001295356.1.23973 WP_001295356.1.23984 WP_001295356.1.23985 WP_001295356.1.24 WP_001295356.1.24004 WP_001295356.1.24024 WP_001295356.1.24038 WP_001295356.1.24045 WP_001295356.1.24051 WP_001295356.1.24058 WP_001295356.1.24068 WP_001295356.1.24070 WP_001295356.1.24088 WP_001295356.1.24089 WP_001295356.1.24120 WP_001295356.1.24122 WP_001295356.1.24124 WP_001295356.1.24127 WP_001295356.1.2413 WP_001295356.1.24136 WP_001295356.1.24169 WP_001295356.1.24177 WP_001295356.1.2418 WP_001295356.1.24194 WP_001295356.1.24233 WP_001295356.1.24278 WP_001295356.1.2428 WP_001295356.1.24283 WP_001295356.1.24290 WP_001295356.1.2430 WP_001295356.1.24304 WP_001295356.1.24316 WP_001295356.1.2433 WP_001295356.1.24341 WP_001295356.1.24362 WP_001295356.1.2437 WP_001295356.1.24374 WP_001295356.1.24381 WP_001295356.1.24383 WP_001295356.1.24458 WP_001295356.1.24460 WP_001295356.1.24473 WP_001295356.1.24483 WP_001295356.1.2449 WP_001295356.1.24499 WP_001295356.1.24523 WP_001295356.1.24524 WP_001295356.1.24533 WP_001295356.1.24536 WP_001295356.1.24547 WP_001295356.1.2456 WP_001295356.1.24560 WP_001295356.1.24570 WP_001295356.1.24575 WP_001295356.1.24577 WP_001295356.1.24583 WP_001295356.1.24592 WP_001295356.1.24616 WP_001295356.1.24641 WP_001295356.1.24642 WP_001295356.1.24646 WP_001295356.1.24650 WP_001295356.1.2469 WP_001295356.1.24693 WP_001295356.1.24695 WP_001295356.1.24703 WP_001295356.1.24752 WP_001295356.1.24753 WP_001295356.1.24758 WP_001295356.1.24763 WP_001295356.1.24773 WP_001295356.1.24783 WP_001295356.1.2479 WP_001295356.1.24791 WP_001295356.1.24797 WP_001295356.1.24799 WP_001295356.1.24808 WP_001295356.1.24854 WP_001295356.1.24870 WP_001295356.1.24876 WP_001295356.1.24899 WP_001295356.1.24902 WP_001295356.1.24906 WP_001295356.1.24909 WP_001295356.1.24926 WP_001295356.1.24929 WP_001295356.1.24939 WP_001295356.1.24946 WP_001295356.1.24960 WP_001295356.1.24968 WP_001295356.1.24979 WP_001295356.1.24981 WP_001295356.1.24982 WP_001295356.1.24984 WP_001295356.1.25019 WP_001295356.1.2502 WP_001295356.1.25021 WP_001295356.1.25038 WP_001295356.1.25039 WP_001295356.1.2504 WP_001295356.1.25042 WP_001295356.1.25050 WP_001295356.1.25060 WP_001295356.1.25076 WP_001295356.1.25079 WP_001295356.1.25082 WP_001295356.1.25085 WP_001295356.1.25086 WP_001295356.1.25087 WP_001295356.1.25088 WP_001295356.1.2512 WP_001295356.1.25126 WP_001295356.1.25141 WP_001295356.1.25174 WP_001295356.1.25183 WP_001295356.1.25193 WP_001295356.1.25201 WP_001295356.1.25203 WP_001295356.1.25204 WP_001295356.1.25248 WP_001295356.1.25270 WP_001295356.1.25272 WP_001295356.1.25289 WP_001295356.1.25305 WP_001295356.1.2531 WP_001295356.1.25312 WP_001295356.1.25324 WP_001295356.1.25346 WP_001295356.1.2537 WP_001295356.1.25372 WP_001295356.1.25378 WP_001295356.1.25380 WP_001295356.1.254 WP_001295356.1.2540 WP_001295356.1.25403 WP_001295356.1.25414 WP_001295356.1.25420 WP_001295356.1.2543 WP_001295356.1.25446 WP_001295356.1.25480 WP_001295356.1.255 WP_001295356.1.25517 WP_001295356.1.25525 WP_001295356.1.25526 WP_001295356.1.25548 WP_001295356.1.25577 WP_001295356.1.2558 WP_001295356.1.25592 WP_001295356.1.25598 WP_001295356.1.25602 WP_001295356.1.25612 WP_001295356.1.25613 WP_001295356.1.25631 WP_001295356.1.25643 WP_001295356.1.25652 WP_001295356.1.2567 WP_001295356.1.25680 WP_001295356.1.25681 WP_001295356.1.25701 WP_001295356.1.25712 WP_001295356.1.25713 WP_001295356.1.25717 WP_001295356.1.25718 WP_001295356.1.25724 WP_001295356.1.25726 WP_001295356.1.25750 WP_001295356.1.25753 WP_001295356.1.25755 WP_001295356.1.25794 WP_001295356.1.25799 WP_001295356.1.25819 WP_001295356.1.25831 WP_001295356.1.25832 WP_001295356.1.25843 WP_001295356.1.25855 WP_001295356.1.25869 WP_001295356.1.25873 WP_001295356.1.2588 WP_001295356.1.25886 WP_001295356.1.2589 WP_001295356.1.25890 WP_001295356.1.25895 WP_001295356.1.25915 WP_001295356.1.25945 WP_001295356.1.2597 WP_001295356.1.25996 WP_001295356.1.26005 WP_001295356.1.26040 WP_001295356.1.26048 WP_001295356.1.26055 WP_001295356.1.2606 WP_001295356.1.26061 WP_001295356.1.26066 WP_001295356.1.26076 WP_001295356.1.26092 WP_001295356.1.26100 WP_001295356.1.26105 WP_001295356.1.2612 WP_001295356.1.26121 WP_001295356.1.26125 WP_001295356.1.26130 WP_001295356.1.26131 WP_001295356.1.26134 WP_001295356.1.26135 WP_001295356.1.26161 WP_001295356.1.26175 WP_001295356.1.26186 WP_001295356.1.26189 WP_001295356.1.26196 WP_001295356.1.26246 WP_001295356.1.26259 WP_001295356.1.26262 WP_001295356.1.26264 WP_001295356.1.26270 WP_001295356.1.26284 WP_001295356.1.26304 WP_001295356.1.26325 WP_001295356.1.26331 WP_001295356.1.2637 WP_001295356.1.26379 WP_001295356.1.26398 WP_001295356.1.26401 WP_001295356.1.26403 WP_001295356.1.26419 WP_001295356.1.2642 WP_001295356.1.26438 WP_001295356.1.26443 WP_001295356.1.26467 WP_001295356.1.26474 WP_001295356.1.26479 WP_001295356.1.26480 WP_001295356.1.26517 WP_001295356.1.26525 WP_001295356.1.26569 WP_001295356.1.26570 WP_001295356.1.26574 WP_001295356.1.26575 WP_001295356.1.26579 WP_001295356.1.26588 WP_001295356.1.26590 WP_001295356.1.26598 WP_001295356.1.26609 WP_001295356.1.26613 WP_001295356.1.26627 WP_001295356.1.26644 WP_001295356.1.2665 WP_001295356.1.26658 WP_001295356.1.26659 WP_001295356.1.26660 WP_001295356.1.26683 WP_001295356.1.26688 WP_001295356.1.26716 WP_001295356.1.26720 WP_001295356.1.26736 WP_001295356.1.26761 WP_001295356.1.26766 WP_001295356.1.26782 WP_001295356.1.26837 WP_001295356.1.26839 WP_001295356.1.26861 WP_001295356.1.26878 WP_001295356.1.2688 WP_001295356.1.26912 WP_001295356.1.26932 WP_001295356.1.26941 WP_001295356.1.26943 WP_001295356.1.2695 WP_001295356.1.26950 WP_001295356.1.26975 WP_001295356.1.26987 WP_001295356.1.26995 WP_001295356.1.26998 WP_001295356.1.2700 WP_001295356.1.27019 WP_001295356.1.27043 WP_001295356.1.27060 WP_001295356.1.27091 WP_001295356.1.27098 WP_001295356.1.27101 WP_001295356.1.27105 WP_001295356.1.2712 WP_001295356.1.27134 WP_001295356.1.27141 WP_001295356.1.27148 WP_001295356.1.27175 WP_001295356.1.27188 WP_001295356.1.27214 WP_001295356.1.27234 WP_001295356.1.27260 WP_001295356.1.27280 WP_001295356.1.27283 WP_001295356.1.27292 WP_001295356.1.2731 WP_001295356.1.27310 WP_001295356.1.27313 WP_001295356.1.27330 WP_001295356.1.27338 WP_001295356.1.27367 WP_001295356.1.27373 WP_001295356.1.27396 WP_001295356.1.27401 WP_001295356.1.27424 WP_001295356.1.27426 WP_001295356.1.27445 WP_001295356.1.2745 WP_001295356.1.27451 WP_001295356.1.27472 WP_001295356.1.27504 WP_001295356.1.27518 WP_001295356.1.27520 WP_001295356.1.27524 WP_001295356.1.2755 WP_001295356.1.27560 WP_001295356.1.27580 WP_001295356.1.27585 WP_001295356.1.27611 WP_001295356.1.27618 WP_001295356.1.27683 WP_001295356.1.27691 WP_001295356.1.27693 WP_001295356.1.27698 WP_001295356.1.27723 WP_001295356.1.27734 WP_001295356.1.27741 WP_001295356.1.27742 WP_001295356.1.27758 WP_001295356.1.27774 WP_001295356.1.27786 WP_001295356.1.2779 WP_001295356.1.27797 WP_001295356.1.2782 WP_001295356.1.27846 WP_001295356.1.27856 WP_001295356.1.27861 WP_001295356.1.27871 WP_001295356.1.27876 WP_001295356.1.27879 WP_001295356.1.27897 WP_001295356.1.27911 WP_001295356.1.27913 WP_001295356.1.27923 WP_001295356.1.27932 WP_001295356.1.2794 WP_001295356.1.27957 WP_001295356.1.27971 WP_001295356.1.27998 WP_001295356.1.28008 WP_001295356.1.28026 WP_001295356.1.28027 WP_001295356.1.28046 WP_001295356.1.28051 WP_001295356.1.28102 WP_001295356.1.2811 WP_001295356.1.28110 WP_001295356.1.28128 WP_001295356.1.28143 WP_001295356.1.28145 WP_001295356.1.28156 WP_001295356.1.28167 WP_001295356.1.28168 WP_001295356.1.28184 WP_001295356.1.2823 WP_001295356.1.28250 WP_001295356.1.2826 WP_001295356.1.28268 WP_001295356.1.28271 WP_001295356.1.28305 WP_001295356.1.28314 WP_001295356.1.28318 WP_001295356.1.28322 WP_001295356.1.28345 WP_001295356.1.28349 WP_001295356.1.28371 WP_001295356.1.2838 WP_001295356.1.28401 WP_001295356.1.28414 WP_001295356.1.28433 WP_001295356.1.28440 WP_001295356.1.28461 WP_001295356.1.28476 WP_001295356.1.28480 WP_001295356.1.28491 WP_001295356.1.28496 WP_001295356.1.285 WP_001295356.1.28500 WP_001295356.1.28509 WP_001295356.1.28523 WP_001295356.1.28536 WP_001295356.1.28544 WP_001295356.1.28551 WP_001295356.1.28554 WP_001295356.1.28568 WP_001295356.1.28639 WP_001295356.1.2866 WP_001295356.1.28662 WP_001295356.1.28683 WP_001295356.1.28697 WP_001295356.1.28711 WP_001295356.1.28723 WP_001295356.1.28732 WP_001295356.1.28734 WP_001295356.1.28736 WP_001295356.1.28742 WP_001295356.1.28760 WP_001295356.1.28762 WP_001295356.1.28769 WP_001295356.1.28791 WP_001295356.1.28809 WP_001295356.1.2881 WP_001295356.1.28829 WP_001295356.1.28835 WP_001295356.1.28842 WP_001295356.1.28863 WP_001295356.1.28879 WP_001295356.1.28919 WP_001295356.1.28924 WP_001295356.1.28950 WP_001295356.1.28953 WP_001295356.1.28982 WP_001295356.1.28994 WP_001295356.1.290 WP_001295356.1.29001 WP_001295356.1.29013 WP_001295356.1.29016 WP_001295356.1.29026 WP_001295356.1.29049 WP_001295356.1.29061 WP_001295356.1.29079 WP_001295356.1.29082 WP_001295356.1.291 WP_001295356.1.29100 WP_001295356.1.29118 WP_001295356.1.29125 WP_001295356.1.29126 WP_001295356.1.29128 WP_001295356.1.29146 WP_001295356.1.29150 WP_001295356.1.29164 WP_001295356.1.29176 WP_001295356.1.29194 WP_001295356.1.29197 WP_001295356.1.29202 WP_001295356.1.29206 WP_001295356.1.29221 WP_001295356.1.29230 WP_001295356.1.29239 WP_001295356.1.29252 WP_001295356.1.29258 WP_001295356.1.2926 WP_001295356.1.2931 WP_001295356.1.29341 WP_001295356.1.29377 WP_001295356.1.29394 WP_001295356.1.29404 WP_001295356.1.2942 WP_001295356.1.29429 WP_001295356.1.29443 WP_001295356.1.2945 WP_001295356.1.29486 WP_001295356.1.29495 WP_001295356.1.29497 WP_001295356.1.29503 WP_001295356.1.29504 WP_001295356.1.29513 WP_001295356.1.2952 WP_001295356.1.29523 WP_001295356.1.2954 WP_001295356.1.29556 WP_001295356.1.29564 WP_001295356.1.29590 WP_001295356.1.29597 WP_001295356.1.29603 WP_001295356.1.29618 WP_001295356.1.2963 WP_001295356.1.29643 WP_001295356.1.29647 WP_001295356.1.29662 WP_001295356.1.29669 WP_001295356.1.29683 WP_001295356.1.29689 WP_001295356.1.29699 WP_001295356.1.29715 WP_001295356.1.29724 WP_001295356.1.29740 WP_001295356.1.29746 WP_001295356.1.29752 WP_001295356.1.2978 WP_001295356.1.29798 WP_001295356.1.29812 WP_001295356.1.29815 WP_001295356.1.29818 WP_001295356.1.29819 WP_001295356.1.29820 WP_001295356.1.29821 WP_001295356.1.29840 WP_001295356.1.29855 WP_001295356.1.2986 WP_001295356.1.29874 WP_001295356.1.29876 WP_001295356.1.29884 WP_001295356.1.29893 WP_001295356.1.29933 WP_001295356.1.2995 WP_001295356.1.29967 WP_001295356.1.29976 WP_001295356.1.29979 WP_001295356.1.29988 WP_001295356.1.29992 WP_001295356.1.30 WP_001295356.1.30004 WP_001295356.1.30016 WP_001295356.1.30019 WP_001295356.1.30035 WP_001295356.1.30052 WP_001295356.1.30063 WP_001295356.1.30064 WP_001295356.1.30098 WP_001295356.1.30105 WP_001295356.1.30123 WP_001295356.1.30141 WP_001295356.1.30164 WP_001295356.1.30178 WP_001295356.1.3018 WP_001295356.1.30221 WP_001295356.1.30222 WP_001295356.1.30231 WP_001295356.1.30232 WP_001295356.1.30239 WP_001295356.1.30247 WP_001295356.1.30253 WP_001295356.1.30269 WP_001295356.1.30298 WP_001295356.1.30347 WP_001295356.1.30391 WP_001295356.1.30397 WP_001295356.1.30399 WP_001295356.1.30400 WP_001295356.1.30401 WP_001295356.1.30428 WP_001295356.1.30447 WP_001295356.1.3045 WP_001295356.1.30452 WP_001295356.1.30472 WP_001295356.1.30476 WP_001295356.1.30479 WP_001295356.1.30497 WP_001295356.1.30524 WP_001295356.1.30536 WP_001295356.1.30546 WP_001295356.1.3055 WP_001295356.1.30550 WP_001295356.1.30554 WP_001295356.1.30570 WP_001295356.1.30580 WP_001295356.1.306 WP_001295356.1.3063 WP_001295356.1.30630 WP_001295356.1.30637 WP_001295356.1.30639 WP_001295356.1.30640 WP_001295356.1.30658 WP_001295356.1.30665 WP_001295356.1.30691 WP_001295356.1.30700 WP_001295356.1.30733 WP_001295356.1.30742 WP_001295356.1.30749 WP_001295356.1.30762 WP_001295356.1.30783 WP_001295356.1.30808 WP_001295356.1.3083 WP_001295356.1.30843 WP_001295356.1.30853 WP_001295356.1.30866 WP_001295356.1.30867 WP_001295356.1.30879 WP_001295356.1.30887 WP_001295356.1.30896 WP_001295356.1.309 WP_001295356.1.30905 WP_001295356.1.30906 WP_001295356.1.30918 WP_001295356.1.30960 WP_001295356.1.30987 WP_001295356.1.30993 WP_001295356.1.30999 WP_001295356.1.31000 WP_001295356.1.31009 WP_001295356.1.31017 WP_001295356.1.31026 WP_001295356.1.31029 WP_001295356.1.31055 WP_001295356.1.31083 WP_001295356.1.31089 WP_001295356.1.31119 WP_001295356.1.31129 WP_001295356.1.31142 WP_001295356.1.31149 WP_001295356.1.31154 WP_001295356.1.31188 WP_001295356.1.312 WP_001295356.1.31211 WP_001295356.1.31252 WP_001295356.1.31295 WP_001295356.1.31319 WP_001295356.1.31340 WP_001295356.1.31347 WP_001295356.1.31353 WP_001295356.1.31357 WP_001295356.1.31372 WP_001295356.1.31379 WP_001295356.1.3140 WP_001295356.1.31401 WP_001295356.1.31407 WP_001295356.1.31419 WP_001295356.1.31421 WP_001295356.1.31422 WP_001295356.1.31429 WP_001295356.1.31431 WP_001295356.1.31433 WP_001295356.1.31434 WP_001295356.1.3147 WP_001295356.1.31482 WP_001295356.1.31506 WP_001295356.1.31511 WP_001295356.1.31518 WP_001295356.1.31521 WP_001295356.1.31527 WP_001295356.1.31542 WP_001295356.1.31557 WP_001295356.1.31559 WP_001295356.1.31575 WP_001295356.1.31596 WP_001295356.1.31614 WP_001295356.1.31618 WP_001295356.1.31625 WP_001295356.1.31639 WP_001295356.1.31657 WP_001295356.1.31675 WP_001295356.1.31679 WP_001295356.1.31681 WP_001295356.1.3169 WP_001295356.1.31696 WP_001295356.1.31709 WP_001295356.1.31715 WP_001295356.1.31736 WP_001295356.1.31740 WP_001295356.1.3176 WP_001295356.1.31801 WP_001295356.1.31803 WP_001295356.1.31809 WP_001295356.1.3181 WP_001295356.1.31823 WP_001295356.1.31825 WP_001295356.1.31833 WP_001295356.1.31835 WP_001295356.1.31839 WP_001295356.1.31860 WP_001295356.1.31863 WP_001295356.1.31866 WP_001295356.1.31878 WP_001295356.1.31898 WP_001295356.1.31899 WP_001295356.1.31903 WP_001295356.1.31924 WP_001295356.1.31928 WP_001295356.1.3193 WP_001295356.1.31937 WP_001295356.1.31956 WP_001295356.1.31978 WP_001295356.1.3201 WP_001295356.1.32020 WP_001295356.1.32021 WP_001295356.1.32024 WP_001295356.1.3203 WP_001295356.1.32030 WP_001295356.1.32037 WP_001295356.1.32049 WP_001295356.1.32063 WP_001295356.1.32078 WP_001295356.1.32089 WP_001295356.1.32091 WP_001295356.1.32093 WP_001295356.1.32094 WP_001295356.1.3212 WP_001295356.1.32121 WP_001295356.1.32127 WP_001295356.1.32138 WP_001295356.1.32142 WP_001295356.1.32143 WP_001295356.1.3215 WP_001295356.1.32173 WP_001295356.1.32184 WP_001295356.1.322 WP_001295356.1.32222 WP_001295356.1.32225 WP_001295356.1.32232 WP_001295356.1.32234 WP_001295356.1.32236 WP_001295356.1.32242 WP_001295356.1.32243 WP_001295356.1.32279 WP_001295356.1.32287 WP_001295356.1.3233 WP_001295356.1.32333 WP_001295356.1.32394 WP_001295356.1.32406 WP_001295356.1.32432 WP_001295356.1.32435 WP_001295356.1.32443 WP_001295356.1.32448 WP_001295356.1.3247 WP_001295356.1.32475 WP_001295356.1.32478 WP_001295356.1.32479 WP_001295356.1.3248 WP_001295356.1.32480 WP_001295356.1.32494 WP_001295356.1.32509 WP_001295356.1.32518 WP_001295356.1.32536 WP_001295356.1.32558 WP_001295356.1.32561 WP_001295356.1.32574 WP_001295356.1.32580 WP_001295356.1.32587 WP_001295356.1.3259 WP_001295356.1.32590 WP_001295356.1.32591 WP_001295356.1.32601 WP_001295356.1.32635 WP_001295356.1.32650 WP_001295356.1.32655 WP_001295356.1.32661 WP_001295356.1.32676 WP_001295356.1.32680 WP_001295356.1.3269 WP_001295356.1.327 WP_001295356.1.32709 WP_001295356.1.32715 WP_001295356.1.32718 WP_001295356.1.32720 WP_001295356.1.32722 WP_001295356.1.32724 WP_001295356.1.32741 WP_001295356.1.32748 WP_001295356.1.32772 WP_001295356.1.32811 WP_001295356.1.32815 WP_001295356.1.32831 WP_001295356.1.32875 WP_001295356.1.32888 WP_001295356.1.32903 WP_001295356.1.32910 WP_001295356.1.32931 WP_001295356.1.32938 WP_001295356.1.32946 WP_001295356.1.3295 WP_001295356.1.32972 WP_001295356.1.32984 WP_001295356.1.32992 WP_001295356.1.32995 WP_001295356.1.33004 WP_001295356.1.33014 WP_001295356.1.33018 WP_001295356.1.33022 WP_001295356.1.33026 WP_001295356.1.33046 WP_001295356.1.33049 WP_001295356.1.33053 WP_001295356.1.33055 WP_001295356.1.33094 WP_001295356.1.33101 WP_001295356.1.33119 WP_001295356.1.33125 WP_001295356.1.33146 WP_001295356.1.33167 WP_001295356.1.33171 WP_001295356.1.33178 WP_001295356.1.33179 WP_001295356.1.33190 WP_001295356.1.33217 WP_001295356.1.33222 WP_001295356.1.3323 WP_001295356.1.33237 WP_001295356.1.33238 WP_001295356.1.33244 WP_001295356.1.33268 WP_001295356.1.33303 WP_001295356.1.33325 WP_001295356.1.33341 WP_001295356.1.33352 WP_001295356.1.33362 WP_001295356.1.33369 WP_001295356.1.33385 WP_001295356.1.334 WP_001295356.1.33408 WP_001295356.1.33410 WP_001295356.1.33413 WP_001295356.1.33422 WP_001295356.1.33424 WP_001295356.1.33428 WP_001295356.1.3344 WP_001295356.1.33475 WP_001295356.1.33476 WP_001295356.1.33502 WP_001295356.1.33512 WP_001295356.1.33525 WP_001295356.1.33526 WP_001295356.1.3354 WP_001295356.1.33545 WP_001295356.1.33561 WP_001295356.1.33563 WP_001295356.1.33565 WP_001295356.1.33584 WP_001295356.1.33595 WP_001295356.1.33631 WP_001295356.1.33638 WP_001295356.1.33648 WP_001295356.1.33667 WP_001295356.1.33680 WP_001295356.1.33729 WP_001295356.1.33736 WP_001295356.1.33745 WP_001295356.1.33746 WP_001295356.1.33751 WP_001295356.1.33780 WP_001295356.1.33799 WP_001295356.1.33823 WP_001295356.1.33853 WP_001295356.1.33854 WP_001295356.1.33879 WP_001295356.1.33888 WP_001295356.1.33896 WP_001295356.1.33905 WP_001295356.1.33914 WP_001295356.1.33948 WP_001295356.1.33952 WP_001295356.1.33973 WP_001295356.1.33974 WP_001295356.1.33979 WP_001295356.1.3398 WP_001295356.1.33981 WP_001295356.1.34003 WP_001295356.1.3401 WP_001295356.1.34032 WP_001295356.1.34094 WP_001295356.1.3411 WP_001295356.1.34117 WP_001295356.1.34121 WP_001295356.1.34122 WP_001295356.1.34124 WP_001295356.1.34130 WP_001295356.1.34144 WP_001295356.1.3415 WP_001295356.1.342 WP_001295356.1.34204 WP_001295356.1.34206 WP_001295356.1.34208 WP_001295356.1.34224 WP_001295356.1.34269 WP_001295356.1.34270 WP_001295356.1.34294 WP_001295356.1.34303 WP_001295356.1.3432 WP_001295356.1.34332 WP_001295356.1.34341 WP_001295356.1.34348 WP_001295356.1.34362 WP_001295356.1.34363 WP_001295356.1.34380 WP_001295356.1.34383 WP_001295356.1.3439 WP_001295356.1.34400 WP_001295356.1.34422 WP_001295356.1.3444 WP_001295356.1.34440 WP_001295356.1.34441 WP_001295356.1.34444 WP_001295356.1.34456 WP_001295356.1.34464 WP_001295356.1.34470 WP_001295356.1.34500 WP_001295356.1.34525 WP_001295356.1.34528 WP_001295356.1.34532 WP_001295356.1.34538 WP_001295356.1.34541 WP_001295356.1.34557 WP_001295356.1.34558 WP_001295356.1.3460 WP_001295356.1.34605 WP_001295356.1.34617 WP_001295356.1.34655 WP_001295356.1.34668 WP_001295356.1.34675 WP_001295356.1.34680 WP_001295356.1.34682 WP_001295356.1.34683 WP_001295356.1.34686 WP_001295356.1.3469 WP_001295356.1.347 WP_001295356.1.3472 WP_001295356.1.34727 WP_001295356.1.34763 WP_001295356.1.34781 WP_001295356.1.34782 WP_001295356.1.34794 WP_001295356.1.34827 WP_001295356.1.34835 WP_001295356.1.34838 WP_001295356.1.34855 WP_001295356.1.34875 WP_001295356.1.34887 WP_001295356.1.34913 WP_001295356.1.34931 WP_001295356.1.34948 WP_001295356.1.34966 WP_001295356.1.34982 WP_001295356.1.34983 WP_001295356.1.34990 WP_001295356.1.34993 WP_001295356.1.35003 WP_001295356.1.35006 WP_001295356.1.35007 WP_001295356.1.35012 WP_001295356.1.35039 WP_001295356.1.35107 WP_001295356.1.35114 WP_001295356.1.35127 WP_001295356.1.35132 WP_001295356.1.3515 WP_001295356.1.35168 WP_001295356.1.35180 WP_001295356.1.35186 WP_001295356.1.35195 WP_001295356.1.35198 WP_001295356.1.35202 WP_001295356.1.35204 WP_001295356.1.35208 WP_001295356.1.3521 WP_001295356.1.35211 WP_001295356.1.35220 WP_001295356.1.35253 WP_001295356.1.35258 WP_001295356.1.35316 WP_001295356.1.35328 WP_001295356.1.35360 WP_001295356.1.35365 WP_001295356.1.35368 WP_001295356.1.35376 WP_001295356.1.3539 WP_001295356.1.35393 WP_001295356.1.35394 WP_001295356.1.35398 WP_001295356.1.35448 WP_001295356.1.35464 WP_001295356.1.35465 WP_001295356.1.35466 WP_001295356.1.35468 WP_001295356.1.35483 WP_001295356.1.3550 WP_001295356.1.35578 WP_001295356.1.35581 WP_001295356.1.3560 WP_001295356.1.35604 WP_001295356.1.35627 WP_001295356.1.35632 WP_001295356.1.35649 WP_001295356.1.35651 WP_001295356.1.35653 WP_001295356.1.35654 WP_001295356.1.35698 WP_001295356.1.35704 WP_001295356.1.35724 WP_001295356.1.35741 WP_001295356.1.35744 WP_001295356.1.35789 WP_001295356.1.35889 WP_001295356.1.35904 WP_001295356.1.35922 WP_001295356.1.35927 WP_001295356.1.35934 WP_001295356.1.35959 WP_001295356.1.35963 WP_001295356.1.3598 WP_001295356.1.35983 WP_001295356.1.35985 WP_001295356.1.35987 WP_001295356.1.35990 WP_001295356.1.3600 WP_001295356.1.36010 WP_001295356.1.36040 WP_001295356.1.36042 WP_001295356.1.36070 WP_001295356.1.36071 WP_001295356.1.36085 WP_001295356.1.36094 WP_001295356.1.36105 WP_001295356.1.36129 WP_001295356.1.36132 WP_001295356.1.36158 WP_001295356.1.36159 WP_001295356.1.36164 WP_001295356.1.36166 WP_001295356.1.36177 WP_001295356.1.36182 WP_001295356.1.3620 WP_001295356.1.36207 WP_001295356.1.36212 WP_001295356.1.3624 WP_001295356.1.36281 WP_001295356.1.36299 WP_001295356.1.36332 WP_001295356.1.36334 WP_001295356.1.36352 WP_001295356.1.36386 WP_001295356.1.36393 WP_001295356.1.36405 WP_001295356.1.36412 WP_001295356.1.36414 WP_001295356.1.36426 WP_001295356.1.3643 WP_001295356.1.36453 WP_001295356.1.36459 WP_001295356.1.36496 WP_001295356.1.365 WP_001295356.1.36500 WP_001295356.1.36507 WP_001295356.1.36523 WP_001295356.1.36531 WP_001295356.1.36537 WP_001295356.1.36545 WP_001295356.1.36610 WP_001295356.1.36626 WP_001295356.1.36627 WP_001295356.1.36628 WP_001295356.1.36667 WP_001295356.1.3668 WP_001295356.1.36699 WP_001295356.1.36707 WP_001295356.1.3671 WP_001295356.1.36724 WP_001295356.1.36739 WP_001295356.1.36746 WP_001295356.1.36747 WP_001295356.1.36761 WP_001295356.1.36767 WP_001295356.1.36786 WP_001295356.1.36799 WP_001295356.1.36806 WP_001295356.1.36812 WP_001295356.1.36817 WP_001295356.1.36826 WP_001295356.1.36833 WP_001295356.1.36856 WP_001295356.1.36886 WP_001295356.1.36894 WP_001295356.1.36904 WP_001295356.1.36925 WP_001295356.1.3697 WP_001295356.1.36971 WP_001295356.1.36975 WP_001295356.1.37006 WP_001295356.1.37020 WP_001295356.1.37032 WP_001295356.1.37046 WP_001295356.1.37049 WP_001295356.1.37057 WP_001295356.1.37076 WP_001295356.1.37099 WP_001295356.1.37101 WP_001295356.1.37102 WP_001295356.1.37103 WP_001295356.1.37122 WP_001295356.1.37146 WP_001295356.1.37153 WP_001295356.1.37155 WP_001295356.1.37206 WP_001295356.1.37226 WP_001295356.1.3723 WP_001295356.1.37233 WP_001295356.1.37252 WP_001295356.1.37261 WP_001295356.1.37266 WP_001295356.1.37290 WP_001295356.1.3730 WP_001295356.1.37306 WP_001295356.1.37312 WP_001295356.1.37313 WP_001295356.1.37329 WP_001295356.1.37334 WP_001295356.1.37337 WP_001295356.1.37342 WP_001295356.1.37352 WP_001295356.1.37360 WP_001295356.1.37371 WP_001295356.1.37372 WP_001295356.1.37388 WP_001295356.1.37419 WP_001295356.1.37423 WP_001295356.1.37433 WP_001295356.1.37445 WP_001295356.1.37472 WP_001295356.1.37476 WP_001295356.1.37477 WP_001295356.1.37485 WP_001295356.1.3749 WP_001295356.1.37510 WP_001295356.1.37516 WP_001295356.1.37538 WP_001295356.1.37543 WP_001295356.1.37544 WP_001295356.1.37548 WP_001295356.1.37549 WP_001295356.1.37550 WP_001295356.1.37554 WP_001295356.1.37576 WP_001295356.1.37588 WP_001295356.1.37592 WP_001295356.1.37608 WP_001295356.1.3762 WP_001295356.1.37634 WP_001295356.1.37637 WP_001295356.1.37664 WP_001295356.1.377 WP_001295356.1.3772 WP_001295356.1.37730 WP_001295356.1.37731 WP_001295356.1.37736 WP_001295356.1.37745 WP_001295356.1.37750 WP_001295356.1.37758 WP_001295356.1.37762 WP_001295356.1.37766 WP_001295356.1.37769 WP_001295356.1.37773 WP_001295356.1.37817 WP_001295356.1.37830 WP_001295356.1.37847 WP_001295356.1.37852 WP_001295356.1.37853 WP_001295356.1.3788 WP_001295356.1.37880 WP_001295356.1.37887 WP_001295356.1.37897 WP_001295356.1.37917 WP_001295356.1.37923 WP_001295356.1.37926 WP_001295356.1.37940 WP_001295356.1.3795 WP_001295356.1.3796 WP_001295356.1.37962 WP_001295356.1.37964 WP_001295356.1.37967 WP_001295356.1.37984 WP_001295356.1.37995 WP_001295356.1.37998 WP_001295356.1.38000 WP_001295356.1.38033 WP_001295356.1.38043 WP_001295356.1.38050 WP_001295356.1.38063 WP_001295356.1.38080 WP_001295356.1.38081 WP_001295356.1.38085 WP_001295356.1.38103 WP_001295356.1.38105 WP_001295356.1.38107 WP_001295356.1.3811 WP_001295356.1.38119 WP_001295356.1.38120 WP_001295356.1.3815 WP_001295356.1.38155 WP_001295356.1.38162 WP_001295356.1.38182 WP_001295356.1.38185 WP_001295356.1.38194 WP_001295356.1.38202 WP_001295356.1.38211 WP_001295356.1.3822 WP_001295356.1.38234 WP_001295356.1.38257 WP_001295356.1.38264 WP_001295356.1.38293 WP_001295356.1.38300 WP_001295356.1.38306 WP_001295356.1.38314 WP_001295356.1.38323 WP_001295356.1.38357 WP_001295356.1.38363 WP_001295356.1.38369 WP_001295356.1.38371 WP_001295356.1.38392 WP_001295356.1.38412 WP_001295356.1.38419 WP_001295356.1.38485 WP_001295356.1.38533 WP_001295356.1.38544 WP_001295356.1.38561 WP_001295356.1.38567 WP_001295356.1.38584 WP_001295356.1.38610 WP_001295356.1.38626 WP_001295356.1.38629 WP_001295356.1.38636 WP_001295356.1.38694 WP_001295356.1.38722 WP_001295356.1.3873 WP_001295356.1.38751 WP_001295356.1.38777 WP_001295356.1.38782 WP_001295356.1.38811 WP_001295356.1.38827 WP_001295356.1.38835 WP_001295356.1.38843 WP_001295356.1.38896 WP_001295356.1.389 WP_001295356.1.38911 WP_001295356.1.38920 WP_001295356.1.38935 WP_001295356.1.38937 WP_001295356.1.38950 WP_001295356.1.38956 WP_001295356.1.38958 WP_001295356.1.39005 WP_001295356.1.39015 WP_001295356.1.3903 WP_001295356.1.39037 WP_001295356.1.3904 WP_001295356.1.39042 WP_001295356.1.39063 WP_001295356.1.39103 WP_001295356.1.39111 WP_001295356.1.3912 WP_001295356.1.39123 WP_001295356.1.39148 WP_001295356.1.39150 WP_001295356.1.39155 WP_001295356.1.39157 WP_001295356.1.39164 WP_001295356.1.39167 WP_001295356.1.39180 WP_001295356.1.39184 WP_001295356.1.39196 WP_001295356.1.39209 WP_001295356.1.3921 WP_001295356.1.3922 WP_001295356.1.39232 WP_001295356.1.39249 WP_001295356.1.39254 WP_001295356.1.39268 WP_001295356.1.39286 WP_001295356.1.39289 WP_001295356.1.39302 WP_001295356.1.39305 WP_001295356.1.39310 WP_001295356.1.39313 WP_001295356.1.39325 WP_001295356.1.39327 WP_001295356.1.39335 WP_001295356.1.39342 WP_001295356.1.39356 WP_001295356.1.39358 WP_001295356.1.39365 WP_001295356.1.39367 WP_001295356.1.39373 WP_001295356.1.39377 WP_001295356.1.39401 WP_001295356.1.39402 WP_001295356.1.39415 WP_001295356.1.39423 WP_001295356.1.39430 WP_001295356.1.39468 WP_001295356.1.39492 WP_001295356.1.39509 WP_001295356.1.39531 WP_001295356.1.3954 WP_001295356.1.39541 WP_001295356.1.39564 WP_001295356.1.39575 WP_001295356.1.39580 WP_001295356.1.39594 WP_001295356.1.39601 WP_001295356.1.39606 WP_001295356.1.39607 WP_001295356.1.39610 WP_001295356.1.39626 WP_001295356.1.39636 WP_001295356.1.39646 WP_001295356.1.39651 WP_001295356.1.39690 WP_001295356.1.3970 WP_001295356.1.39708 WP_001295356.1.39709 WP_001295356.1.39713 WP_001295356.1.39715 WP_001295356.1.39717 WP_001295356.1.39726 WP_001295356.1.39730 WP_001295356.1.39733 WP_001295356.1.39734 WP_001295356.1.39780 WP_001295356.1.39796 WP_001295356.1.3980 WP_001295356.1.39809 WP_001295356.1.39818 WP_001295356.1.39820 WP_001295356.1.39822 WP_001295356.1.39829 WP_001295356.1.39867 WP_001295356.1.39870 WP_001295356.1.39892 WP_001295356.1.39938 WP_001295356.1.39961 WP_001295356.1.39966 WP_001295356.1.39970 WP_001295356.1.39973 WP_001295356.1.39992 WP_001295356.1.39998 WP_001295356.1.40 WP_001295356.1.40013 WP_001295356.1.40016 WP_001295356.1.40019 WP_001295356.1.4005 WP_001295356.1.40083 WP_001295356.1.40088 WP_001295356.1.40107 WP_001295356.1.40113 WP_001295356.1.40121 WP_001295356.1.40140 WP_001295356.1.40147 WP_001295356.1.40153 WP_001295356.1.40159 WP_001295356.1.40183 WP_001295356.1.40190 WP_001295356.1.40192 WP_001295356.1.4020 WP_001295356.1.40206 WP_001295356.1.40211 WP_001295356.1.40212 WP_001295356.1.40218 WP_001295356.1.40234 WP_001295356.1.40238 WP_001295356.1.40249 WP_001295356.1.40298 WP_001295356.1.4030 WP_001295356.1.40300 WP_001295356.1.40315 WP_001295356.1.40317 WP_001295356.1.40319 WP_001295356.1.40335 WP_001295356.1.40345 WP_001295356.1.40349 WP_001295356.1.40360 WP_001295356.1.40382 WP_001295356.1.40389 WP_001295356.1.40391 WP_001295356.1.40403 WP_001295356.1.40445 WP_001295356.1.40486 WP_001295356.1.4049 WP_001295356.1.40499 WP_001295356.1.40502 WP_001295356.1.40524 WP_001295356.1.40539 WP_001295356.1.40548 WP_001295356.1.40549 WP_001295356.1.40560 WP_001295356.1.40563 WP_001295356.1.40596 WP_001295356.1.40599 WP_001295356.1.406 WP_001295356.1.40607 WP_001295356.1.40617 WP_001295356.1.40623 WP_001295356.1.40629 WP_001295356.1.40636 WP_001295356.1.40657 WP_001295356.1.40660 WP_001295356.1.40666 WP_001295356.1.40668 WP_001295356.1.40686 WP_001295356.1.40712 WP_001295356.1.40715 WP_001295356.1.40742 WP_001295356.1.40758 WP_001295356.1.40781 WP_001295356.1.40793 WP_001295356.1.4081 WP_001295356.1.40813 WP_001295356.1.40815 WP_001295356.1.4082 WP_001295356.1.40833 WP_001295356.1.40842 WP_001295356.1.40843 WP_001295356.1.40865 WP_001295356.1.40882 WP_001295356.1.40893 WP_001295356.1.40898 WP_001295356.1.40900 WP_001295356.1.40912 WP_001295356.1.40937 WP_001295356.1.40952 WP_001295356.1.40965 WP_001295356.1.4103 WP_001295356.1.41037 WP_001295356.1.41041 WP_001295356.1.41045 WP_001295356.1.41060 WP_001295356.1.41063 WP_001295356.1.41078 WP_001295356.1.41113 WP_001295356.1.41125 WP_001295356.1.41147 WP_001295356.1.41206 WP_001295356.1.4122 WP_001295356.1.41230 WP_001295356.1.41239 WP_001295356.1.41244 WP_001295356.1.41259 WP_001295356.1.4126 WP_001295356.1.41263 WP_001295356.1.41271 WP_001295356.1.41287 WP_001295356.1.41294 WP_001295356.1.41315 WP_001295356.1.41330 WP_001295356.1.41332 WP_001295356.1.41339 WP_001295356.1.41346 WP_001295356.1.41363 WP_001295356.1.41368 WP_001295356.1.41371 WP_001295356.1.41372 WP_001295356.1.41391 WP_001295356.1.41392 WP_001295356.1.41394 WP_001295356.1.41401 WP_001295356.1.41402 WP_001295356.1.41407 WP_001295356.1.41417 WP_001295356.1.4142 WP_001295356.1.41436 WP_001295356.1.41449 WP_001295356.1.41453 WP_001295356.1.41455 WP_001295356.1.41457 WP_001295356.1.41466 WP_001295356.1.41478 WP_001295356.1.41479 WP_001295356.1.41481 WP_001295356.1.41482 WP_001295356.1.41483 WP_001295356.1.41484 WP_001295356.1.41488 WP_001295356.1.41513 WP_001295356.1.41530 WP_001295356.1.41536 WP_001295356.1.41539 WP_001295356.1.41545 WP_001295356.1.41556 WP_001295356.1.41566 WP_001295356.1.4158 WP_001295356.1.41606 WP_001295356.1.41613 WP_001295356.1.41621 WP_001295356.1.41651 WP_001295356.1.41654 WP_001295356.1.41712 WP_001295356.1.41718 WP_001295356.1.4172 WP_001295356.1.41734 WP_001295356.1.41740 WP_001295356.1.41741 WP_001295356.1.41752 WP_001295356.1.41778 WP_001295356.1.41780 WP_001295356.1.41782 WP_001295356.1.41783 WP_001295356.1.41784 WP_001295356.1.41809 WP_001295356.1.41812 WP_001295356.1.41813 WP_001295356.1.41822 WP_001295356.1.41826 WP_001295356.1.41837 WP_001295356.1.41847 WP_001295356.1.41849 WP_001295356.1.41884 WP_001295356.1.4189 WP_001295356.1.41900 WP_001295356.1.41923 WP_001295356.1.4193 WP_001295356.1.41956 WP_001295356.1.41960 WP_001295356.1.41964 WP_001295356.1.41988 WP_001295356.1.41990 WP_001295356.1.41991 WP_001295356.1.42022 WP_001295356.1.42027 WP_001295356.1.42033 WP_001295356.1.42036 WP_001295356.1.42038 WP_001295356.1.42044 WP_001295356.1.42060 WP_001295356.1.42073 WP_001295356.1.42095 WP_001295356.1.42096 WP_001295356.1.42113 WP_001295356.1.4213 WP_001295356.1.42138 WP_001295356.1.4214 WP_001295356.1.42151 WP_001295356.1.42159 WP_001295356.1.42179 WP_001295356.1.42191 WP_001295356.1.42203 WP_001295356.1.42209 WP_001295356.1.42214 WP_001295356.1.42221 WP_001295356.1.42226 WP_001295356.1.42228 WP_001295356.1.42233 WP_001295356.1.4224 WP_001295356.1.42252 WP_001295356.1.42258 WP_001295356.1.42277 WP_001295356.1.42284 WP_001295356.1.42300 WP_001295356.1.42318 WP_001295356.1.42350 WP_001295356.1.42359 WP_001295356.1.42367 WP_001295356.1.42369 WP_001295356.1.42376 WP_001295356.1.42387 WP_001295356.1.42413 WP_001295356.1.42415 WP_001295356.1.4242 WP_001295356.1.42432 WP_001295356.1.42442 WP_001295356.1.42443 WP_001295356.1.42447 WP_001295356.1.42448 WP_001295356.1.42456 WP_001295356.1.42480 WP_001295356.1.4250 WP_001295356.1.42513 WP_001295356.1.42516 WP_001295356.1.42522 WP_001295356.1.42547 WP_001295356.1.42586 WP_001295356.1.42594 WP_001295356.1.42597 WP_001295356.1.42600 WP_001295356.1.42601 WP_001295356.1.4261 WP_001295356.1.42632 WP_001295356.1.42638 WP_001295356.1.42661 WP_001295356.1.42669 WP_001295356.1.42670 WP_001295356.1.42677 WP_001295356.1.42709 WP_001295356.1.42728 WP_001295356.1.42748 WP_001295356.1.42749 WP_001295356.1.42750 WP_001295356.1.42756 WP_001295356.1.42761 WP_001295356.1.42770 WP_001295356.1.42771 WP_001295356.1.42791 WP_001295356.1.42804 WP_001295356.1.42808 WP_001295356.1.4282 WP_001295356.1.42828 WP_001295356.1.42830 WP_001295356.1.42832 WP_001295356.1.42863 WP_001295356.1.42879 WP_001295356.1.42891 WP_001295356.1.4290 WP_001295356.1.42903 WP_001295356.1.42918 WP_001295356.1.42936 WP_001295356.1.42937 WP_001295356.1.42950 WP_001295356.1.42962 WP_001295356.1.42966 WP_001295356.1.42970 WP_001295356.1.42975 WP_001295356.1.42987 WP_001295356.1.42989 WP_001295356.1.42991 WP_001295356.1.43013 WP_001295356.1.43027 WP_001295356.1.43035 WP_001295356.1.4306 WP_001295356.1.43079 WP_001295356.1.43121 WP_001295356.1.43123 WP_001295356.1.4313 WP_001295356.1.43132 WP_001295356.1.43133 WP_001295356.1.43137 WP_001295356.1.43140 WP_001295356.1.43166 WP_001295356.1.43170 WP_001295356.1.43174 WP_001295356.1.43177 WP_001295356.1.43196 WP_001295356.1.43213 WP_001295356.1.43216 WP_001295356.1.43239 WP_001295356.1.43270 WP_001295356.1.43278 WP_001295356.1.43316 WP_001295356.1.43324 WP_001295356.1.4334 WP_001295356.1.43363 WP_001295356.1.43374 WP_001295356.1.43384 WP_001295356.1.43389 WP_001295356.1.4342 WP_001295356.1.43422 WP_001295356.1.43427 WP_001295356.1.4343 WP_001295356.1.43444 WP_001295356.1.43448 WP_001295356.1.43455 WP_001295356.1.43469 WP_001295356.1.43473 WP_001295356.1.43474 WP_001295356.1.43489 WP_001295356.1.43501 WP_001295356.1.43536 WP_001295356.1.4356 WP_001295356.1.43561 WP_001295356.1.43566 WP_001295356.1.43598 WP_001295356.1.436 WP_001295356.1.43604 WP_001295356.1.43622 WP_001295356.1.43642 WP_001295356.1.43720 WP_001295356.1.43733 WP_001295356.1.43738 WP_001295356.1.43750 WP_001295356.1.43754 WP_001295356.1.43769 WP_001295356.1.43798 WP_001295356.1.43803 WP_001295356.1.43804 WP_001295356.1.43816 WP_001295356.1.43837 WP_001295356.1.43858 WP_001295356.1.43868 WP_001295356.1.43898 WP_001295356.1.43911 WP_001295356.1.43918 WP_001295356.1.43925 WP_001295356.1.43939 WP_001295356.1.43942 WP_001295356.1.43953 WP_001295356.1.43966 WP_001295356.1.43989 WP_001295356.1.440 WP_001295356.1.4400 WP_001295356.1.44018 WP_001295356.1.44020 WP_001295356.1.44029 WP_001295356.1.44040 WP_001295356.1.44051 WP_001295356.1.44075 WP_001295356.1.44077 WP_001295356.1.44088 WP_001295356.1.44096 WP_001295356.1.4411 WP_001295356.1.44115 WP_001295356.1.44125 WP_001295356.1.44130 WP_001295356.1.44133 WP_001295356.1.4415 WP_001295356.1.44162 WP_001295356.1.44165 WP_001295356.1.44166 WP_001295356.1.44201 WP_001295356.1.44203 WP_001295356.1.44211 WP_001295356.1.44222 WP_001295356.1.44238 WP_001295356.1.44251 WP_001295356.1.44263 WP_001295356.1.44264 WP_001295356.1.44273 WP_001295356.1.44285 WP_001295356.1.44287 WP_001295356.1.44292 WP_001295356.1.44314 WP_001295356.1.44324 WP_001295356.1.44327 WP_001295356.1.44354 WP_001295356.1.44365 WP_001295356.1.44389 WP_001295356.1.44394 WP_001295356.1.44422 WP_001295356.1.44424 WP_001295356.1.44426 WP_001295356.1.44445 WP_001295356.1.44447 WP_001295356.1.4445 WP_001295356.1.44452 WP_001295356.1.44458 WP_001295356.1.44460 WP_001295356.1.44488 WP_001295356.1.4449 WP_001295356.1.44524 WP_001295356.1.44539 WP_001295356.1.4454 WP_001295356.1.44558 WP_001295356.1.44561 WP_001295356.1.44570 WP_001295356.1.44587 WP_001295356.1.4459 WP_001295356.1.44608 WP_001295356.1.44610 WP_001295356.1.44622 WP_001295356.1.44627 WP_001295356.1.4463 WP_001295356.1.44642 WP_001295356.1.44649 WP_001295356.1.44661 WP_001295356.1.44668 WP_001295356.1.44671 WP_001295356.1.44686 WP_001295356.1.4471 WP_001295356.1.44717 WP_001295356.1.44724 WP_001295356.1.4473 WP_001295356.1.44733 WP_001295356.1.44756 WP_001295356.1.44759 WP_001295356.1.44784 WP_001295356.1.448 WP_001295356.1.44800 WP_001295356.1.44814 WP_001295356.1.44818 WP_001295356.1.44821 WP_001295356.1.44836 WP_001295356.1.44840 WP_001295356.1.44841 WP_001295356.1.44843 WP_001295356.1.44848 WP_001295356.1.44849 WP_001295356.1.44854 WP_001295356.1.44855 WP_001295356.1.44857 WP_001295356.1.44906 WP_001295356.1.44923 WP_001295356.1.44954 WP_001295356.1.44961 WP_001295356.1.44970 WP_001295356.1.44975 WP_001295356.1.44977 WP_001295356.1.44980 WP_001295356.1.45000 WP_001295356.1.45020 WP_001295356.1.45025 WP_001295356.1.45028 WP_001295356.1.45043 WP_001295356.1.45053 WP_001295356.1.45068 WP_001295356.1.45076 WP_001295356.1.45104 WP_001295356.1.45116 WP_001295356.1.4515 WP_001295356.1.45153 WP_001295356.1.45156 WP_001295356.1.4516 WP_001295356.1.45190 WP_001295356.1.45195 WP_001295356.1.45208 WP_001295356.1.4524 WP_001295356.1.45246 WP_001295356.1.45293 WP_001295356.1.4530 WP_001295356.1.45301 WP_001295356.1.45313 WP_001295356.1.45329 WP_001295356.1.4535 WP_001295356.1.45359 WP_001295356.1.4538 WP_001295356.1.45392 WP_001295356.1.45404 WP_001295356.1.45405 WP_001295356.1.4541 WP_001295356.1.45440 WP_001295356.1.45444 WP_001295356.1.45486 WP_001295356.1.4549 WP_001295356.1.45494 WP_001295356.1.45500 WP_001295356.1.45525 WP_001295356.1.45536 WP_001295356.1.45538 WP_001295356.1.45565 WP_001295356.1.45575 WP_001295356.1.45581 WP_001295356.1.45595 WP_001295356.1.45600 WP_001295356.1.45627 WP_001295356.1.4563 WP_001295356.1.45664 WP_001295356.1.45674 WP_001295356.1.45676 WP_001295356.1.4570 WP_001295356.1.45707 WP_001295356.1.45718 WP_001295356.1.4574 WP_001295356.1.45740 WP_001295356.1.45741 WP_001295356.1.45752 WP_001295356.1.4576 WP_001295356.1.45789 WP_001295356.1.45793 WP_001295356.1.45799 WP_001295356.1.45801 WP_001295356.1.45806 WP_001295356.1.4583 WP_001295356.1.45840 WP_001295356.1.45841 WP_001295356.1.45846 WP_001295356.1.45865 WP_001295356.1.45868 WP_001295356.1.45891 WP_001295356.1.45901 WP_001295356.1.45921 WP_001295356.1.4593 WP_001295356.1.45930 WP_001295356.1.45931 WP_001295356.1.45933 WP_001295356.1.45941 WP_001295356.1.45945 WP_001295356.1.45949 WP_001295356.1.45960 WP_001295356.1.45962 WP_001295356.1.45968 WP_001295356.1.45990 WP_001295356.1.45991 WP_001295356.1.4600 WP_001295356.1.46016 WP_001295356.1.46026 WP_001295356.1.46027 WP_001295356.1.46039 WP_001295356.1.46048 WP_001295356.1.46049 WP_001295356.1.46070 WP_001295356.1.46081 WP_001295356.1.46097 WP_001295356.1.4610 WP_001295356.1.46105 WP_001295356.1.46115 WP_001295356.1.46122 WP_001295356.1.4613 WP_001295356.1.46164 WP_001295356.1.4617 WP_001295356.1.46186 WP_001295356.1.4619 WP_001295356.1.46197 WP_001295356.1.46213 WP_001295356.1.46217 WP_001295356.1.46239 WP_001295356.1.46245 WP_001295356.1.46257 WP_001295356.1.46263 WP_001295356.1.46282 WP_001295356.1.46283 WP_001295356.1.46291 WP_001295356.1.46301 WP_001295356.1.46325 WP_001295356.1.46329 WP_001295356.1.46369 WP_001295356.1.46378 WP_001295356.1.46379 WP_001295356.1.46414 WP_001295356.1.46429 WP_001295356.1.4643 WP_001295356.1.46433 WP_001295356.1.46438 WP_001295356.1.46441 WP_001295356.1.46451 WP_001295356.1.4646 WP_001295356.1.46468 WP_001295356.1.4647 WP_001295356.1.46477 WP_001295356.1.46487 WP_001295356.1.46503 WP_001295356.1.46526 WP_001295356.1.46531 WP_001295356.1.46541 WP_001295356.1.46552 WP_001295356.1.46555 WP_001295356.1.4657 WP_001295356.1.46573 WP_001295356.1.46582 WP_001295356.1.46589 WP_001295356.1.46594 WP_001295356.1.46597 WP_001295356.1.46611 WP_001295356.1.46614 WP_001295356.1.46616 WP_001295356.1.46626 WP_001295356.1.46643 WP_001295356.1.46655 WP_001295356.1.46668 WP_001295356.1.4670 WP_001295356.1.46734 WP_001295356.1.46743 WP_001295356.1.46795 WP_001295356.1.46798 WP_001295356.1.46802 WP_001295356.1.46806 WP_001295356.1.46810 WP_001295356.1.46820 WP_001295356.1.46821 WP_001295356.1.46832 WP_001295356.1.46833 WP_001295356.1.46841 WP_001295356.1.46857 WP_001295356.1.46860 WP_001295356.1.46882 WP_001295356.1.46909 WP_001295356.1.46912 WP_001295356.1.46913 WP_001295356.1.46932 WP_001295356.1.4695 WP_001295356.1.46990 WP_001295356.1.46991 WP_001295356.1.46994 WP_001295356.1.46999 WP_001295356.1.47024 WP_001295356.1.47028 WP_001295356.1.47029 WP_001295356.1.47030 WP_001295356.1.47034 WP_001295356.1.47038 WP_001295356.1.47039 WP_001295356.1.47047 WP_001295356.1.47048 WP_001295356.1.47050 WP_001295356.1.47054 WP_001295356.1.47063 WP_001295356.1.47069 WP_001295356.1.47073 WP_001295356.1.4708 WP_001295356.1.47124 WP_001295356.1.47135 WP_001295356.1.47140 WP_001295356.1.47156 WP_001295356.1.47167 WP_001295356.1.47186 WP_001295356.1.47189 WP_001295356.1.47197 WP_001295356.1.47198 WP_001295356.1.4722 WP_001295356.1.47224 WP_001295356.1.4723 WP_001295356.1.47235 WP_001295356.1.47246 WP_001295356.1.47247 WP_001295356.1.4725 WP_001295356.1.47280 WP_001295356.1.47307 WP_001295356.1.47316 WP_001295356.1.47319 WP_001295356.1.47322 WP_001295356.1.47332 WP_001295356.1.47344 WP_001295356.1.47349 WP_001295356.1.47350 WP_001295356.1.47356 WP_001295356.1.47363 WP_001295356.1.47366 WP_001295356.1.47370 WP_001295356.1.47386 WP_001295356.1.47398 WP_001295356.1.4740 WP_001295356.1.47401 WP_001295356.1.47411 WP_001295356.1.47414 WP_001295356.1.47416 WP_001295356.1.47425 WP_001295356.1.4743 WP_001295356.1.47451 WP_001295356.1.47454 WP_001295356.1.47464 WP_001295356.1.47473 WP_001295356.1.47477 WP_001295356.1.47488 WP_001295356.1.47496 WP_001295356.1.47498 WP_001295356.1.47500 WP_001295356.1.47529 WP_001295356.1.47533 WP_001295356.1.47546 WP_001295356.1.47582 WP_001295356.1.47599 WP_001295356.1.47634 WP_001295356.1.47646 WP_001295356.1.47647 WP_001295356.1.47654 WP_001295356.1.47662 WP_001295356.1.47673 WP_001295356.1.47709 WP_001295356.1.4772 WP_001295356.1.47722 WP_001295356.1.4773 WP_001295356.1.47734 WP_001295356.1.47740 WP_001295356.1.47744 WP_001295356.1.47761 WP_001295356.1.47764 WP_001295356.1.47765 WP_001295356.1.47770 WP_001295356.1.47775 WP_001295356.1.47784 WP_001295356.1.47790 WP_001295356.1.47791 WP_001295356.1.47820 WP_001295356.1.47827 WP_001295356.1.4783 WP_001295356.1.47837 WP_001295356.1.47848 WP_001295356.1.47884 WP_001295356.1.47914 WP_001295356.1.47935 WP_001295356.1.47954 WP_001295356.1.4796 WP_001295356.1.47962 WP_001295356.1.47976 WP_001295356.1.47981 WP_001295356.1.47983 WP_001295356.1.47994 WP_001295356.1.48000 WP_001295356.1.48018 WP_001295356.1.48029 WP_001295356.1.48040 WP_001295356.1.48048 WP_001295356.1.48051 WP_001295356.1.48065 WP_001295356.1.48073 WP_001295356.1.48077 WP_001295356.1.48080 WP_001295356.1.48087 WP_001295356.1.48090 WP_001295356.1.48096 WP_001295356.1.4811 WP_001295356.1.48111 WP_001295356.1.4812 WP_001295356.1.48121 WP_001295356.1.48144 WP_001295356.1.48168 WP_001295356.1.48176 WP_001295356.1.48188 WP_001295356.1.48194 WP_001295356.1.48200 WP_001295356.1.48203 WP_001295356.1.48216 WP_001295356.1.48222 WP_001295356.1.48226 WP_001295356.1.48229 WP_001295356.1.48258 WP_001295356.1.4826 WP_001295356.1.48265 WP_001295356.1.48285 WP_001295356.1.48290 WP_001295356.1.48291 WP_001295356.1.48317 WP_001295356.1.48353 WP_001295356.1.48355 WP_001295356.1.48371 WP_001295356.1.48385 WP_001295356.1.48404 WP_001295356.1.48417 WP_001295356.1.48421 WP_001295356.1.48431 WP_001295356.1.48433 WP_001295356.1.48469 WP_001295356.1.48477 WP_001295356.1.48480 WP_001295356.1.48483 WP_001295356.1.48505 WP_001295356.1.48522 WP_001295356.1.4857 WP_001295356.1.48571 WP_001295356.1.48590 WP_001295356.1.486 WP_001295356.1.48602 WP_001295356.1.48615 WP_001295356.1.48620 WP_001295356.1.48626 WP_001295356.1.48629 WP_001295356.1.48678 WP_001295356.1.48689 WP_001295356.1.48697 WP_001295356.1.4871 WP_001295356.1.48712 WP_001295356.1.4876 WP_001295356.1.48792 WP_001295356.1.48801 WP_001295356.1.48806 WP_001295356.1.48808 WP_001295356.1.48825 WP_001295356.1.48827 WP_001295356.1.48847 WP_001295356.1.48860 WP_001295356.1.48901 WP_001295356.1.48902 WP_001295356.1.48907 WP_001295356.1.48910 WP_001295356.1.4892 WP_001295356.1.48921 WP_001295356.1.48926 WP_001295356.1.48928 WP_001295356.1.48953 WP_001295356.1.48954 WP_001295356.1.48970 WP_001295356.1.48974 WP_001295356.1.49001 WP_001295356.1.49009 WP_001295356.1.49061 WP_001295356.1.49076 WP_001295356.1.49104 WP_001295356.1.49107 WP_001295356.1.49124 WP_001295356.1.49136 WP_001295356.1.49141 WP_001295356.1.49147 WP_001295356.1.49170 WP_001295356.1.49179 WP_001295356.1.49190 WP_001295356.1.49229 WP_001295356.1.49236 WP_001295356.1.49243 WP_001295356.1.49258 WP_001295356.1.49259 WP_001295356.1.49275 WP_001295356.1.4931 WP_001295356.1.49312 WP_001295356.1.49321 WP_001295356.1.49332 WP_001295356.1.49336 WP_001295356.1.49338 WP_001295356.1.49342 WP_001295356.1.49347 WP_001295356.1.49363 WP_001295356.1.49376 WP_001295356.1.49401 WP_001295356.1.49412 WP_001295356.1.49431 WP_001295356.1.49446 WP_001295356.1.49459 WP_001295356.1.49464 WP_001295356.1.49481 WP_001295356.1.49482 WP_001295356.1.49483 WP_001295356.1.4949 WP_001295356.1.49496 WP_001295356.1.49521 WP_001295356.1.49522 WP_001295356.1.49528 WP_001295356.1.4953 WP_001295356.1.49531 WP_001295356.1.49537 WP_001295356.1.49546 WP_001295356.1.49558 WP_001295356.1.49567 WP_001295356.1.49594 WP_001295356.1.49599 WP_001295356.1.49615 WP_001295356.1.49621 WP_001295356.1.49625 WP_001295356.1.49645 WP_001295356.1.49655 WP_001295356.1.49661 WP_001295356.1.49662 WP_001295356.1.49675 WP_001295356.1.49684 WP_001295356.1.497 WP_001295356.1.49712 WP_001295356.1.49722 WP_001295356.1.49733 WP_001295356.1.49740 WP_001295356.1.49747 WP_001295356.1.49768 WP_001295356.1.49771 WP_001295356.1.49774 WP_001295356.1.49777 WP_001295356.1.49783 WP_001295356.1.49788 WP_001295356.1.49794 WP_001295356.1.49820 WP_001295356.1.49823 WP_001295356.1.4985 WP_001295356.1.49856 WP_001295356.1.49861 WP_001295356.1.49879 WP_001295356.1.49883 WP_001295356.1.49884 WP_001295356.1.49900 WP_001295356.1.49902 WP_001295356.1.49941 WP_001295356.1.49950 WP_001295356.1.49954 WP_001295356.1.49972 WP_001295356.1.49987 WP_001295356.1.50006 WP_001295356.1.50008 WP_001295356.1.5003 WP_001295356.1.50036 WP_001295356.1.50056 WP_001295356.1.50058 WP_001295356.1.50078 WP_001295356.1.50098 WP_001295356.1.50110 WP_001295356.1.50113 WP_001295356.1.50119 WP_001295356.1.50136 WP_001295356.1.50146 WP_001295356.1.5017 WP_001295356.1.50179 WP_001295356.1.50182 WP_001295356.1.50187 WP_001295356.1.50191 WP_001295356.1.50196 WP_001295356.1.50207 WP_001295356.1.50214 WP_001295356.1.50228 WP_001295356.1.50230 WP_001295356.1.50258 WP_001295356.1.50262 WP_001295356.1.50266 WP_001295356.1.50269 WP_001295356.1.50270 WP_001295356.1.50273 WP_001295356.1.50278 WP_001295356.1.50329 WP_001295356.1.50345 WP_001295356.1.50353 WP_001295356.1.50358 WP_001295356.1.50361 WP_001295356.1.5037 WP_001295356.1.50380 WP_001295356.1.50381 WP_001295356.1.5040 WP_001295356.1.5041 WP_001295356.1.50412 WP_001295356.1.50418 WP_001295356.1.50427 WP_001295356.1.50446 WP_001295356.1.50452 WP_001295356.1.5046 WP_001295356.1.50539 WP_001295356.1.50548 WP_001295356.1.50549 WP_001295356.1.5056 WP_001295356.1.50564 WP_001295356.1.50579 WP_001295356.1.50585 WP_001295356.1.50586 WP_001295356.1.506 WP_001295356.1.50608 WP_001295356.1.5061 WP_001295356.1.50616 WP_001295356.1.50627 WP_001295356.1.5064 WP_001295356.1.5067 WP_001295356.1.50690 WP_001295356.1.50700 WP_001295356.1.50715 WP_001295356.1.50717 WP_001295356.1.50725 WP_001295356.1.50728 WP_001295356.1.50762 WP_001295356.1.50887 WP_001295356.1.50925 WP_001295356.1.50936 WP_001295356.1.50939 WP_001295356.1.50947 WP_001295356.1.5095 WP_001295356.1.50957 WP_001295356.1.50969 WP_001295356.1.50986 WP_001295356.1.50988 WP_001295356.1.50990 WP_001295356.1.50993 WP_001295356.1.51013 WP_001295356.1.51027 WP_001295356.1.51042 WP_001295356.1.51058 WP_001295356.1.5106 WP_001295356.1.511 WP_001295356.1.51109 WP_001295356.1.51127 WP_001295356.1.51154 WP_001295356.1.51170 WP_001295356.1.51171 WP_001295356.1.51172 WP_001295356.1.51175 WP_001295356.1.51180 WP_001295356.1.51190 WP_001295356.1.51201 WP_001295356.1.51203 WP_001295356.1.51206 WP_001295356.1.51211 WP_001295356.1.5124 WP_001295356.1.51248 WP_001295356.1.51253 WP_001295356.1.51255 WP_001295356.1.51260 WP_001295356.1.51278 WP_001295356.1.5128 WP_001295356.1.51283 WP_001295356.1.51299 WP_001295356.1.51300 WP_001295356.1.51307 WP_001295356.1.51320 WP_001295356.1.51323 WP_001295356.1.51325 WP_001295356.1.51330 WP_001295356.1.51336 WP_001295356.1.51354 WP_001295356.1.51360 WP_001295356.1.51364 WP_001295356.1.51380 WP_001295356.1.51392 WP_001295356.1.51405 WP_001295356.1.51425 WP_001295356.1.51426 WP_001295356.1.51427 WP_001295356.1.51430 WP_001295356.1.51441 WP_001295356.1.5146 WP_001295356.1.51462 WP_001295356.1.51482 WP_001295356.1.51490 WP_001295356.1.51495 WP_001295356.1.51503 WP_001295356.1.51505 WP_001295356.1.51513 WP_001295356.1.51525 WP_001295356.1.5153 WP_001295356.1.51537 WP_001295356.1.51539 WP_001295356.1.51542 WP_001295356.1.51548 WP_001295356.1.51552 WP_001295356.1.5157 WP_001295356.1.5158 WP_001295356.1.51580 WP_001295356.1.51587 WP_001295356.1.51596 WP_001295356.1.51600 WP_001295356.1.51607 WP_001295356.1.51624 WP_001295356.1.51629 WP_001295356.1.51643 WP_001295356.1.51662 WP_001295356.1.51690 WP_001295356.1.51693 WP_001295356.1.51718 WP_001295356.1.5172 WP_001295356.1.51736 WP_001295356.1.51757 WP_001295356.1.51760 WP_001295356.1.51784 WP_001295356.1.518 WP_001295356.1.51804 WP_001295356.1.51834 WP_001295356.1.51837 WP_001295356.1.51839 WP_001295356.1.51869 WP_001295356.1.51873 WP_001295356.1.51881 WP_001295356.1.51896 WP_001295356.1.51899 WP_001295356.1.51906 WP_001295356.1.51944 WP_001295356.1.51949 WP_001295356.1.51968 WP_001295356.1.51979 WP_001295356.1.51985 WP_001295356.1.51988 WP_001295356.1.5199 WP_001295356.1.52002 WP_001295356.1.52011 WP_001295356.1.52020 WP_001295356.1.52039 WP_001295356.1.52044 WP_001295356.1.52048 WP_001295356.1.52062 WP_001295356.1.52076 WP_001295356.1.52085 WP_001295356.1.52098 WP_001295356.1.52111 WP_001295356.1.52126 WP_001295356.1.52127 WP_001295356.1.52135 WP_001295356.1.52137 WP_001295356.1.5217 WP_001295356.1.52171 WP_001295356.1.52186 WP_001295356.1.52200 WP_001295356.1.52211 WP_001295356.1.52213 WP_001295356.1.52214 WP_001295356.1.52225 WP_001295356.1.52230 WP_001295356.1.52236 WP_001295356.1.52240 WP_001295356.1.52243 WP_001295356.1.52249 WP_001295356.1.52257 WP_001295356.1.52258 WP_001295356.1.5227 WP_001295356.1.52270 WP_001295356.1.52271 WP_001295356.1.52272 WP_001295356.1.52299 WP_001295356.1.52304 WP_001295356.1.52305 WP_001295356.1.52313 WP_001295356.1.52324 WP_001295356.1.52328 WP_001295356.1.52333 WP_001295356.1.52363 WP_001295356.1.52378 WP_001295356.1.5239 WP_001295356.1.52399 WP_001295356.1.52406 WP_001295356.1.52413 WP_001295356.1.52419 WP_001295356.1.52421 WP_001295356.1.52492 WP_001295356.1.52496 WP_001295356.1.52524 WP_001295356.1.52542 WP_001295356.1.52543 WP_001295356.1.52544 WP_001295356.1.52554 WP_001295356.1.52558 WP_001295356.1.52567 WP_001295356.1.52568 WP_001295356.1.52601 WP_001295356.1.52631 WP_001295356.1.5265 WP_001295356.1.52662 WP_001295356.1.52691 WP_001295356.1.52704 WP_001295356.1.52710 WP_001295356.1.5272 WP_001295356.1.52735 WP_001295356.1.52755 WP_001295356.1.52762 WP_001295356.1.52771 WP_001295356.1.52774 WP_001295356.1.52777 WP_001295356.1.52780 WP_001295356.1.52781 WP_001295356.1.52801 WP_001295356.1.52804 WP_001295356.1.52844 WP_001295356.1.52846 WP_001295356.1.5285 WP_001295356.1.52852 WP_001295356.1.52853 WP_001295356.1.52855 WP_001295356.1.52881 WP_001295356.1.52883 WP_001295356.1.52895 WP_001295356.1.52908 WP_001295356.1.5291 WP_001295356.1.52913 WP_001295356.1.52933 WP_001295356.1.52942 WP_001295356.1.52945 WP_001295356.1.52962 WP_001295356.1.52995 WP_001295356.1.52996 WP_001295356.1.53012 WP_001295356.1.53020 WP_001295356.1.53021 WP_001295356.1.53065 WP_001295356.1.53084 WP_001295356.1.53095 WP_001295356.1.53099 WP_001295356.1.5310 WP_001295356.1.53110 WP_001295356.1.53123 WP_001295356.1.53155 WP_001295356.1.53162 WP_001295356.1.53181 WP_001295356.1.53186 WP_001295356.1.532 WP_001295356.1.53211 WP_001295356.1.5322 WP_001295356.1.53223 WP_001295356.1.53228 WP_001295356.1.53238 WP_001295356.1.53242 WP_001295356.1.53244 WP_001295356.1.53251 WP_001295356.1.53252 WP_001295356.1.53262 WP_001295356.1.53270 WP_001295356.1.53277 WP_001295356.1.53308 WP_001295356.1.53327 WP_001295356.1.53356 WP_001295356.1.53360 WP_001295356.1.53364 WP_001295356.1.53377 WP_001295356.1.53401 WP_001295356.1.53410 WP_001295356.1.53415 WP_001295356.1.53419 WP_001295356.1.5342 WP_001295356.1.53428 WP_001295356.1.53431 WP_001295356.1.53482 WP_001295356.1.53505 WP_001295356.1.5351 WP_001295356.1.53535 WP_001295356.1.53537 WP_001295356.1.53545 WP_001295356.1.53556 WP_001295356.1.53557 WP_001295356.1.53574 WP_001295356.1.53582 WP_001295356.1.53587 WP_001295356.1.53589 WP_001295356.1.53590 WP_001295356.1.53592 WP_001295356.1.53594 WP_001295356.1.5362 WP_001295356.1.53642 WP_001295356.1.53645 WP_001295356.1.53649 WP_001295356.1.53687 WP_001295356.1.53690 WP_001295356.1.53693 WP_001295356.1.53769 WP_001295356.1.53809 WP_001295356.1.53810 WP_001295356.1.53811 WP_001295356.1.53841 WP_001295356.1.53845 WP_001295356.1.53863 WP_001295356.1.53866 WP_001295356.1.53878 WP_001295356.1.53884 WP_001295356.1.5391 WP_001295356.1.5393 WP_001295356.1.53931 WP_001295356.1.53940 WP_001295356.1.5395 WP_001295356.1.53966 WP_001295356.1.53968 WP_001295356.1.53972 WP_001295356.1.53978 WP_001295356.1.53991 WP_001295356.1.53994 WP_001295356.1.54002 WP_001295356.1.54013 WP_001295356.1.54023 WP_001295356.1.54024 WP_001295356.1.54028 WP_001295356.1.54032 WP_001295356.1.54051 WP_001295356.1.54072 WP_001295356.1.54091 WP_001295356.1.54095 WP_001295356.1.54102 WP_001295356.1.54104 WP_001295356.1.54144 WP_001295356.1.54169 WP_001295356.1.54185 WP_001295356.1.54188 WP_001295356.1.54202 WP_001295356.1.54208 WP_001295356.1.54213 WP_001295356.1.54263 WP_001295356.1.54307 WP_001295356.1.54313 WP_001295356.1.54317 WP_001295356.1.54328 WP_001295356.1.54329 WP_001295356.1.5433 WP_001295356.1.5434 WP_001295356.1.54344 WP_001295356.1.54359 WP_001295356.1.54388 WP_001295356.1.54394 WP_001295356.1.5440 WP_001295356.1.5441 WP_001295356.1.54411 WP_001295356.1.54417 WP_001295356.1.54418 WP_001295356.1.54429 WP_001295356.1.54439 WP_001295356.1.54454 WP_001295356.1.54463 WP_001295356.1.54476 WP_001295356.1.54507 WP_001295356.1.54524 WP_001295356.1.54534 WP_001295356.1.54546 WP_001295356.1.54585 WP_001295356.1.54590 WP_001295356.1.54591 WP_001295356.1.5460 WP_001295356.1.54601 WP_001295356.1.54602 WP_001295356.1.54605 WP_001295356.1.5461 WP_001295356.1.54614 WP_001295356.1.54617 WP_001295356.1.54620 WP_001295356.1.54625 WP_001295356.1.54638 WP_001295356.1.54641 WP_001295356.1.54643 WP_001295356.1.5467 WP_001295356.1.54688 WP_001295356.1.54695 WP_001295356.1.5470 WP_001295356.1.54708 WP_001295356.1.54725 WP_001295356.1.54729 WP_001295356.1.54754 WP_001295356.1.54755 WP_001295356.1.54760 WP_001295356.1.54769 WP_001295356.1.5478 WP_001295356.1.5479 WP_001295356.1.54798 WP_001295356.1.54817 WP_001295356.1.54829 WP_001295356.1.5486 WP_001295356.1.54875 WP_001295356.1.54883 WP_001295356.1.54918 WP_001295356.1.54921 WP_001295356.1.54927 WP_001295356.1.54940 WP_001295356.1.54941 WP_001295356.1.54946 WP_001295356.1.54972 WP_001295356.1.54981 WP_001295356.1.54989 WP_001295356.1.54991 WP_001295356.1.54993 WP_001295356.1.55003 WP_001295356.1.55005 WP_001295356.1.55009 WP_001295356.1.55041 WP_001295356.1.55070 WP_001295356.1.55112 WP_001295356.1.55115 WP_001295356.1.55123 WP_001295356.1.55134 WP_001295356.1.55144 WP_001295356.1.55149 WP_001295356.1.55177 WP_001295356.1.55179 WP_001295356.1.55185 WP_001295356.1.55197 WP_001295356.1.5520 WP_001295356.1.55203 WP_001295356.1.55218 WP_001295356.1.55222 WP_001295356.1.55226 WP_001295356.1.55273 WP_001295356.1.55275 WP_001295356.1.55286 WP_001295356.1.55291 WP_001295356.1.55338 WP_001295356.1.55357 WP_001295356.1.55359 WP_001295356.1.55374 WP_001295356.1.55381 WP_001295356.1.55417 WP_001295356.1.55420 WP_001295356.1.55425 WP_001295356.1.5546 WP_001295356.1.55466 WP_001295356.1.55472 WP_001295356.1.55482 WP_001295356.1.55483 WP_001295356.1.55489 WP_001295356.1.55492 WP_001295356.1.55507 WP_001295356.1.55529 WP_001295356.1.55550 WP_001295356.1.55551 WP_001295356.1.55552 WP_001295356.1.55556 WP_001295356.1.55560 WP_001295356.1.55563 WP_001295356.1.55571 WP_001295356.1.55574 WP_001295356.1.55581 WP_001295356.1.55597 WP_001295356.1.55608 WP_001295356.1.5561 WP_001295356.1.55629 WP_001295356.1.5566 WP_001295356.1.55676 WP_001295356.1.55709 WP_001295356.1.55720 WP_001295356.1.55727 WP_001295356.1.55730 WP_001295356.1.55731 WP_001295356.1.55744 WP_001295356.1.55757 WP_001295356.1.55787 WP_001295356.1.55790 WP_001295356.1.55791 WP_001295356.1.55808 WP_001295356.1.55820 WP_001295356.1.55825 WP_001295356.1.55838 WP_001295356.1.55844 WP_001295356.1.55868 WP_001295356.1.55870 WP_001295356.1.55888 WP_001295356.1.55892 WP_001295356.1.55896 WP_001295356.1.55897 WP_001295356.1.55936 WP_001295356.1.55979 WP_001295356.1.55981 WP_001295356.1.55988 WP_001295356.1.55990 WP_001295356.1.56033 WP_001295356.1.56040 WP_001295356.1.56047 WP_001295356.1.56072 WP_001295356.1.561 WP_001295356.1.56101 WP_001295356.1.56122 WP_001295356.1.56139 WP_001295356.1.5614 WP_001295356.1.56142 WP_001295356.1.56149 WP_001295356.1.56151 WP_001295356.1.5616 WP_001295356.1.56164 WP_001295356.1.56169 WP_001295356.1.56177 WP_001295356.1.56193 WP_001295356.1.56197 WP_001295356.1.562 WP_001295356.1.56216 WP_001295356.1.56231 WP_001295356.1.56278 WP_001295356.1.56285 WP_001295356.1.56293 WP_001295356.1.56302 WP_001295356.1.5632 WP_001295356.1.56338 WP_001295356.1.56345 WP_001295356.1.56358 WP_001295356.1.56371 WP_001295356.1.56388 WP_001295356.1.5639 WP_001295356.1.56390 WP_001295356.1.56392 WP_001295356.1.56399 WP_001295356.1.56402 WP_001295356.1.56436 WP_001295356.1.56439 WP_001295356.1.56446 WP_001295356.1.56457 WP_001295356.1.5646 WP_001295356.1.56469 WP_001295356.1.56481 WP_001295356.1.56489 WP_001295356.1.5649 WP_001295356.1.56491 WP_001295356.1.56501 WP_001295356.1.56502 WP_001295356.1.56513 WP_001295356.1.56523 WP_001295356.1.56528 WP_001295356.1.56543 WP_001295356.1.56554 WP_001295356.1.56571 WP_001295356.1.56586 WP_001295356.1.56650 WP_001295356.1.56662 WP_001295356.1.56665 WP_001295356.1.56680 WP_001295356.1.56689 WP_001295356.1.5670 WP_001295356.1.56704 WP_001295356.1.56713 WP_001295356.1.56714 WP_001295356.1.56721 WP_001295356.1.56742 WP_001295356.1.56776 WP_001295356.1.56777 WP_001295356.1.56786 WP_001295356.1.56787 WP_001295356.1.56789 WP_001295356.1.56799 WP_001295356.1.56821 WP_001295356.1.56830 WP_001295356.1.56835 WP_001295356.1.56846 WP_001295356.1.5685 WP_001295356.1.56871 WP_001295356.1.56882 WP_001295356.1.56885 WP_001295356.1.56908 WP_001295356.1.56932 WP_001295356.1.56933 WP_001295356.1.56934 WP_001295356.1.56936 WP_001295356.1.56937 WP_001295356.1.56941 WP_001295356.1.56951 WP_001295356.1.56978 WP_001295356.1.56980 WP_001295356.1.56992 WP_001295356.1.57011 WP_001295356.1.57032 WP_001295356.1.57045 WP_001295356.1.57051 WP_001295356.1.57068 WP_001295356.1.57071 WP_001295356.1.57072 WP_001295356.1.57079 WP_001295356.1.57086 WP_001295356.1.57100 WP_001295356.1.57150 WP_001295356.1.57159 WP_001295356.1.57180 WP_001295356.1.57181 WP_001295356.1.57182 WP_001295356.1.57185 WP_001295356.1.57197 WP_001295356.1.57202 WP_001295356.1.57213 WP_001295356.1.57216 WP_001295356.1.57222 WP_001295356.1.57254 WP_001295356.1.57266 WP_001295356.1.57269 WP_001295356.1.57278 WP_001295356.1.57280 WP_001295356.1.57281 WP_001295356.1.57319 WP_001295356.1.57348 WP_001295356.1.57349 WP_001295356.1.57395 WP_001295356.1.57401 WP_001295356.1.57403 WP_001295356.1.57410 WP_001295356.1.57414 WP_001295356.1.5742 WP_001295356.1.57432 WP_001295356.1.57438 WP_001295356.1.57451 WP_001295356.1.57453 WP_001295356.1.57466 WP_001295356.1.5748 WP_001295356.1.57487 WP_001295356.1.57492 WP_001295356.1.57517 WP_001295356.1.57538 WP_001295356.1.57539 WP_001295356.1.5755 WP_001295356.1.57550 WP_001295356.1.57558 WP_001295356.1.57574 WP_001295356.1.57588 WP_001295356.1.57608 WP_001295356.1.57610 WP_001295356.1.57628 WP_001295356.1.57634 WP_001295356.1.57638 WP_001295356.1.5764 WP_001295356.1.57646 WP_001295356.1.57659 WP_001295356.1.57663 WP_001295356.1.57669 WP_001295356.1.57719 WP_001295356.1.57738 WP_001295356.1.57812 WP_001295356.1.57814 WP_001295356.1.57832 WP_001295356.1.57836 WP_001295356.1.57846 WP_001295356.1.57851 WP_001295356.1.57854 WP_001295356.1.5786 WP_001295356.1.5787 WP_001295356.1.57898 WP_001295356.1.57903 WP_001295356.1.57904 WP_001295356.1.57920 WP_001295356.1.57951 WP_001295356.1.57975 WP_001295356.1.57982 WP_001295356.1.57983 WP_001295356.1.57994 WP_001295356.1.58001 WP_001295356.1.58009 WP_001295356.1.58022 WP_001295356.1.58038 WP_001295356.1.58045 WP_001295356.1.58048 WP_001295356.1.58057 WP_001295356.1.58060 WP_001295356.1.58080 WP_001295356.1.58092 WP_001295356.1.58094 WP_001295356.1.58097 WP_001295356.1.58098 WP_001295356.1.5810 WP_001295356.1.58107 WP_001295356.1.5812 WP_001295356.1.58128 WP_001295356.1.58136 WP_001295356.1.58146 WP_001295356.1.58163 WP_001295356.1.58169 WP_001295356.1.58172 WP_001295356.1.58206 WP_001295356.1.58226 WP_001295356.1.58232 WP_001295356.1.58233 WP_001295356.1.58238 WP_001295356.1.58244 WP_001295356.1.58248 WP_001295356.1.58267 WP_001295356.1.58289 WP_001295356.1.58292 WP_001295356.1.58316 WP_001295356.1.58336 WP_001295356.1.58340 WP_001295356.1.58345 WP_001295356.1.58368 WP_001295356.1.58371 WP_001295356.1.58384 WP_001295356.1.584 WP_001295356.1.58401 WP_001295356.1.58408 WP_001295356.1.58414 WP_001295356.1.5842 WP_001295356.1.58420 WP_001295356.1.58423 WP_001295356.1.58424 WP_001295356.1.58429 WP_001295356.1.58440 WP_001295356.1.58444 WP_001295356.1.58449 WP_001295356.1.58459 WP_001295356.1.58475 WP_001295356.1.58484 WP_001295356.1.58493 WP_001295356.1.58496 WP_001295356.1.585 WP_001295356.1.58507 WP_001295356.1.58514 WP_001295356.1.5852 WP_001295356.1.58528 WP_001295356.1.58547 WP_001295356.1.58552 WP_001295356.1.58560 WP_001295356.1.58572 WP_001295356.1.58609 WP_001295356.1.58617 WP_001295356.1.58622 WP_001295356.1.58657 WP_001295356.1.58680 WP_001295356.1.58692 WP_001295356.1.58705 WP_001295356.1.58707 WP_001295356.1.58723 WP_001295356.1.58737 WP_001295356.1.58799 WP_001295356.1.58837 WP_001295356.1.58867 WP_001295356.1.58870 WP_001295356.1.58901 WP_001295356.1.58940 WP_001295356.1.58942 WP_001295356.1.58951 WP_001295356.1.58958 WP_001295356.1.58976 WP_001295356.1.58977 WP_001295356.1.58983 WP_001295356.1.58999 WP_001295356.1.59024 WP_001295356.1.59026 WP_001295356.1.59035 WP_001295356.1.59038 WP_001295356.1.59047 WP_001295356.1.59055 WP_001295356.1.5906 WP_001295356.1.59060 WP_001295356.1.59073 WP_001295356.1.59119 WP_001295356.1.59165 WP_001295356.1.59174 WP_001295356.1.59190 WP_001295356.1.59199 WP_001295356.1.59218 WP_001295356.1.59226 WP_001295356.1.59263 WP_001295356.1.5927 WP_001295356.1.59280 WP_001295356.1.59291 WP_001295356.1.59292 WP_001295356.1.59293 WP_001295356.1.59306 WP_001295356.1.59359 WP_001295356.1.59374 WP_001295356.1.59395 WP_001295356.1.59396 WP_001295356.1.59407 WP_001295356.1.59409 WP_001295356.1.59413 WP_001295356.1.5942 WP_001295356.1.59423 WP_001295356.1.59425 WP_001295356.1.59426 WP_001295356.1.59434 WP_001295356.1.59470 WP_001295356.1.59483 WP_001295356.1.59491 WP_001295356.1.59513 WP_001295356.1.59533 WP_001295356.1.59553 WP_001295356.1.59572 WP_001295356.1.59577 WP_001295356.1.59579 WP_001295356.1.59590 WP_001295356.1.59611 WP_001295356.1.59613 WP_001295356.1.59615 WP_001295356.1.59621 WP_001295356.1.5963 WP_001295356.1.5965 WP_001295356.1.59660 WP_001295356.1.59679 WP_001295356.1.59689 WP_001295356.1.59699 WP_001295356.1.597 WP_001295356.1.59714 WP_001295356.1.59717 WP_001295356.1.59730 WP_001295356.1.59733 WP_001295356.1.59737 WP_001295356.1.59745 WP_001295356.1.59748 WP_001295356.1.59756 WP_001295356.1.59781 WP_001295356.1.59782 WP_001295356.1.59788 WP_001295356.1.59791 WP_001295356.1.59793 WP_001295356.1.59815 WP_001295356.1.59823 WP_001295356.1.59838 WP_001295356.1.59853 WP_001295356.1.59855 WP_001295356.1.59858 WP_001295356.1.59877 WP_001295356.1.59894 WP_001295356.1.5990 WP_001295356.1.59900 WP_001295356.1.59905 WP_001295356.1.59912 WP_001295356.1.59914 WP_001295356.1.59931 WP_001295356.1.59932 WP_001295356.1.59959 WP_001295356.1.59970 WP_001295356.1.59980 WP_001295356.1.59981 WP_001295356.1.59989 WP_001295356.1.59998 WP_001295356.1.60005 WP_001295356.1.6002 WP_001295356.1.60023 WP_001295356.1.60031 WP_001295356.1.60042 WP_001295356.1.60043 WP_001295356.1.60048 WP_001295356.1.60067 WP_001295356.1.60070 WP_001295356.1.60095 WP_001295356.1.60096 WP_001295356.1.60110 WP_001295356.1.60117 WP_001295356.1.6013 WP_001295356.1.60133 WP_001295356.1.60151 WP_001295356.1.60186 WP_001295356.1.6022 WP_001295356.1.60225 WP_001295356.1.60228 WP_001295356.1.60235 WP_001295356.1.60246 WP_001295356.1.60304 WP_001295356.1.60325 WP_001295356.1.60337 WP_001295356.1.60342 WP_001295356.1.60343 WP_001295356.1.60350 WP_001295356.1.60373 WP_001295356.1.60374 WP_001295356.1.60387 WP_001295356.1.60411 WP_001295356.1.60436 WP_001295356.1.60443 WP_001295356.1.60453 WP_001295356.1.60457 WP_001295356.1.60461 WP_001295356.1.60477 WP_001295356.1.60491 WP_001295356.1.60498 WP_001295356.1.60505 WP_001295356.1.60544 WP_001295356.1.60550 WP_001295356.1.60555 WP_001295356.1.60559 WP_001295356.1.60567 WP_001295356.1.60570 WP_001295356.1.6059 WP_001295356.1.60591 WP_001295356.1.60599 WP_001295356.1.60606 WP_001295356.1.6061 WP_001295356.1.60613 WP_001295356.1.60614 WP_001295356.1.60630 WP_001295356.1.6064 WP_001295356.1.60644 WP_001295356.1.60647 WP_001295356.1.60654 WP_001295356.1.6066 WP_001295356.1.60671 WP_001295356.1.6068 WP_001295356.1.60684 WP_001295356.1.60698 WP_001295356.1.60717 WP_001295356.1.60732 WP_001295356.1.60744 WP_001295356.1.60761 WP_001295356.1.60764 WP_001295356.1.60771 WP_001295356.1.60784 WP_001295356.1.60805 WP_001295356.1.60816 WP_001295356.1.60826 WP_001295356.1.60832 WP_001295356.1.60835 WP_001295356.1.60847 WP_001295356.1.60872 WP_001295356.1.60895 WP_001295356.1.60901 WP_001295356.1.60921 WP_001295356.1.60925 WP_001295356.1.60927 WP_001295356.1.60935 WP_001295356.1.6094 WP_001295356.1.60974 WP_001295356.1.61005 WP_001295356.1.61006 WP_001295356.1.61008 WP_001295356.1.61035 WP_001295356.1.61039 WP_001295356.1.61046 WP_001295356.1.61058 WP_001295356.1.6106 WP_001295356.1.61096 WP_001295356.1.61097 WP_001295356.1.61099 WP_001295356.1.6110 WP_001295356.1.61102 WP_001295356.1.61108 WP_001295356.1.61112 WP_001295356.1.61121 WP_001295356.1.61132 WP_001295356.1.61148 WP_001295356.1.61170 WP_001295356.1.61174 WP_001295356.1.61175 WP_001295356.1.61181 WP_001295356.1.61183 WP_001295356.1.61186 WP_001295356.1.61223 WP_001295356.1.61225 WP_001295356.1.61241 WP_001295356.1.61245 WP_001295356.1.61253 WP_001295356.1.61268 WP_001295356.1.61284 WP_001295356.1.61292 WP_001295356.1.613 WP_001295356.1.61360 WP_001295356.1.61362 WP_001295356.1.61364 WP_001295356.1.61373 WP_001295356.1.6138 WP_001295356.1.61398 WP_001295356.1.61442 WP_001295356.1.61445 WP_001295356.1.61480 WP_001295356.1.61496 WP_001295356.1.615 WP_001295356.1.61505 WP_001295356.1.61517 WP_001295356.1.61524 WP_001295356.1.61551 WP_001295356.1.61608 WP_001295356.1.61612 WP_001295356.1.61617 WP_001295356.1.61623 WP_001295356.1.61636 WP_001295356.1.61643 WP_001295356.1.61663 WP_001295356.1.61703 WP_001295356.1.61718 WP_001295356.1.61739 WP_001295356.1.61758 WP_001295356.1.61770 WP_001295356.1.61772 WP_001295356.1.61779 WP_001295356.1.61789 WP_001295356.1.618 WP_001295356.1.61806 WP_001295356.1.61822 WP_001295356.1.61835 WP_001295356.1.61853 WP_001295356.1.61858 WP_001295356.1.61874 WP_001295356.1.61893 WP_001295356.1.61926 WP_001295356.1.61939 WP_001295356.1.61948 WP_001295356.1.61949 WP_001295356.1.61955 WP_001295356.1.61957 WP_001295356.1.61966 WP_001295356.1.61985 WP_001295356.1.62015 WP_001295356.1.62038 WP_001295356.1.62041 WP_001295356.1.62043 WP_001295356.1.62091 WP_001295356.1.62099 WP_001295356.1.62102 WP_001295356.1.6212 WP_001295356.1.62135 WP_001295356.1.62157 WP_001295356.1.62182 WP_001295356.1.62207 WP_001295356.1.62236 WP_001295356.1.62262 WP_001295356.1.62264 WP_001295356.1.62266 WP_001295356.1.62282 WP_001295356.1.62290 WP_001295356.1.62296 WP_001295356.1.62303 WP_001295356.1.62322 WP_001295356.1.62337 WP_001295356.1.62348 WP_001295356.1.62358 WP_001295356.1.62424 WP_001295356.1.62447 WP_001295356.1.6245 WP_001295356.1.62454 WP_001295356.1.62460 WP_001295356.1.62480 WP_001295356.1.62481 WP_001295356.1.62487 WP_001295356.1.62503 WP_001295356.1.62507 WP_001295356.1.62513 WP_001295356.1.62514 WP_001295356.1.62529 WP_001295356.1.62541 WP_001295356.1.62555 WP_001295356.1.62586 WP_001295356.1.6261 WP_001295356.1.62612 WP_001295356.1.62631 WP_001295356.1.62646 WP_001295356.1.62668 WP_001295356.1.62675 WP_001295356.1.62681 WP_001295356.1.62714 WP_001295356.1.62735 WP_001295356.1.62750 WP_001295356.1.62762 WP_001295356.1.62769 WP_001295356.1.62780 WP_001295356.1.62784 WP_001295356.1.62787 WP_001295356.1.62788 WP_001295356.1.62802 WP_001295356.1.62812 WP_001295356.1.62818 WP_001295356.1.62819 WP_001295356.1.6282 WP_001295356.1.62840 WP_001295356.1.62843 WP_001295356.1.62850 WP_001295356.1.62851 WP_001295356.1.62866 WP_001295356.1.62885 WP_001295356.1.62888 WP_001295356.1.62914 WP_001295356.1.62919 WP_001295356.1.6293 WP_001295356.1.62951 WP_001295356.1.62959 WP_001295356.1.62973 WP_001295356.1.62989 WP_001295356.1.6299 WP_001295356.1.62992 WP_001295356.1.63023 WP_001295356.1.6307 WP_001295356.1.63078 WP_001295356.1.63113 WP_001295356.1.63167 WP_001295356.1.63177 WP_001295356.1.63189 WP_001295356.1.6323 WP_001295356.1.63246 WP_001295356.1.63271 WP_001295356.1.63285 WP_001295356.1.63287 WP_001295356.1.63305 WP_001295356.1.6331 WP_001295356.1.63310 WP_001295356.1.63330 WP_001295356.1.6334 WP_001295356.1.63350 WP_001295356.1.6337 WP_001295356.1.63370 WP_001295356.1.63374 WP_001295356.1.63393 WP_001295356.1.63419 WP_001295356.1.63433 WP_001295356.1.63435 WP_001295356.1.63437 WP_001295356.1.63444 WP_001295356.1.63445 WP_001295356.1.63453 WP_001295356.1.63465 WP_001295356.1.63466 WP_001295356.1.63467 WP_001295356.1.63470 WP_001295356.1.63478 WP_001295356.1.6348 WP_001295356.1.63484 WP_001295356.1.63487 WP_001295356.1.63491 WP_001295356.1.63496 WP_001295356.1.63536 WP_001295356.1.63554 WP_001295356.1.63556 WP_001295356.1.63563 WP_001295356.1.63576 WP_001295356.1.63586 WP_001295356.1.63602 WP_001295356.1.63604 WP_001295356.1.63608 WP_001295356.1.63612 WP_001295356.1.63615 WP_001295356.1.6364 WP_001295356.1.63666 WP_001295356.1.63679 WP_001295356.1.63683 WP_001295356.1.63703 WP_001295356.1.63721 WP_001295356.1.63746 WP_001295356.1.63800 WP_001295356.1.63810 WP_001295356.1.63814 WP_001295356.1.63856 WP_001295356.1.63871 WP_001295356.1.63872 WP_001295356.1.63944 WP_001295356.1.63957 WP_001295356.1.63964 WP_001295356.1.63969 WP_001295356.1.63990 WP_001295356.1.64008 WP_001295356.1.64014 WP_001295356.1.64030 WP_001295356.1.64040 WP_001295356.1.64045 WP_001295356.1.64050 WP_001295356.1.64053 WP_001295356.1.64074 WP_001295356.1.64080 WP_001295356.1.64086 WP_001295356.1.64110 WP_001295356.1.64138 WP_001295356.1.64150 WP_001295356.1.64153 WP_001295356.1.6416 WP_001295356.1.64161 WP_001295356.1.64165 WP_001295356.1.64175 WP_001295356.1.64180 WP_001295356.1.64190 WP_001295356.1.64193 WP_001295356.1.64280 WP_001295356.1.64285 WP_001295356.1.64286 WP_001295356.1.643 WP_001295356.1.6431 WP_001295356.1.64312 WP_001295356.1.64321 WP_001295356.1.64330 WP_001295356.1.64337 WP_001295356.1.64353 WP_001295356.1.64355 WP_001295356.1.64356 WP_001295356.1.64371 WP_001295356.1.64380 WP_001295356.1.64391 WP_001295356.1.64417 WP_001295356.1.64437 WP_001295356.1.64438 WP_001295356.1.6444 WP_001295356.1.64448 WP_001295356.1.6445 WP_001295356.1.64458 WP_001295356.1.6446 WP_001295356.1.64519 WP_001295356.1.64520 WP_001295356.1.64528 WP_001295356.1.64540 WP_001295356.1.64547 WP_001295356.1.64563 WP_001295356.1.64621 WP_001295356.1.64634 WP_001295356.1.64657 WP_001295356.1.64670 WP_001295356.1.6469 WP_001295356.1.64693 WP_001295356.1.64695 WP_001295356.1.647 WP_001295356.1.64707 WP_001295356.1.64712 WP_001295356.1.64746 WP_001295356.1.64749 WP_001295356.1.64784 WP_001295356.1.64789 WP_001295356.1.64793 WP_001295356.1.64821 WP_001295356.1.64840 WP_001295356.1.64866 WP_001295356.1.64875 WP_001295356.1.64881 WP_001295356.1.64895 WP_001295356.1.64901 WP_001295356.1.64912 WP_001295356.1.64926 WP_001295356.1.64930 WP_001295356.1.64939 WP_001295356.1.64946 WP_001295356.1.64970 WP_001295356.1.6499 WP_001295356.1.64990 WP_001295356.1.6500 WP_001295356.1.65023 WP_001295356.1.65035 WP_001295356.1.65040 WP_001295356.1.65056 WP_001295356.1.65061 WP_001295356.1.65084 WP_001295356.1.65085 WP_001295356.1.65097 WP_001295356.1.651 WP_001295356.1.65104 WP_001295356.1.6511 WP_001295356.1.65110 WP_001295356.1.65114 WP_001295356.1.65116 WP_001295356.1.65118 WP_001295356.1.65122 WP_001295356.1.65135 WP_001295356.1.65151 WP_001295356.1.65155 WP_001295356.1.6516 WP_001295356.1.65179 WP_001295356.1.65192 WP_001295356.1.65194 WP_001295356.1.65206 WP_001295356.1.65240 WP_001295356.1.65256 WP_001295356.1.6527 WP_001295356.1.65271 WP_001295356.1.65286 WP_001295356.1.65296 WP_001295356.1.65305 WP_001295356.1.65306 WP_001295356.1.65353 WP_001295356.1.65355 WP_001295356.1.65364 WP_001295356.1.65366 WP_001295356.1.6537 WP_001295356.1.65370 WP_001295356.1.65372 WP_001295356.1.654 WP_001295356.1.65405 WP_001295356.1.65408 WP_001295356.1.65413 WP_001295356.1.65415 WP_001295356.1.65456 WP_001295356.1.65484 WP_001295356.1.65493 WP_001295356.1.6553 WP_001295356.1.65531 WP_001295356.1.65546 WP_001295356.1.65565 WP_001295356.1.65571 WP_001295356.1.65581 WP_001295356.1.65596 WP_001295356.1.65606 WP_001295356.1.6563 WP_001295356.1.65662 WP_001295356.1.65667 WP_001295356.1.65672 WP_001295356.1.65677 WP_001295356.1.65708 WP_001295356.1.65714 WP_001295356.1.65749 WP_001295356.1.6576 WP_001295356.1.65762 WP_001295356.1.65834 WP_001295356.1.6587 WP_001295356.1.65875 WP_001295356.1.65898 WP_001295356.1.65912 WP_001295356.1.65954 WP_001295356.1.65957 WP_001295356.1.65961 WP_001295356.1.65962 WP_001295356.1.65963 WP_001295356.1.65976 WP_001295356.1.65978 WP_001295356.1.65988 WP_001295356.1.6599 WP_001295356.1.65991 WP_001295356.1.66001 WP_001295356.1.66007 WP_001295356.1.66016 WP_001295356.1.66017 WP_001295356.1.66022 WP_001295356.1.66033 WP_001295356.1.6604 WP_001295356.1.66044 WP_001295356.1.66050 WP_001295356.1.66059 WP_001295356.1.66071 WP_001295356.1.6609 WP_001295356.1.66094 WP_001295356.1.66100 WP_001295356.1.66102 WP_001295356.1.66104 WP_001295356.1.66105 WP_001295356.1.66121 WP_001295356.1.66127 WP_001295356.1.66161 WP_001295356.1.6618 WP_001295356.1.66181 WP_001295356.1.66197 WP_001295356.1.6622 WP_001295356.1.66251 WP_001295356.1.66255 WP_001295356.1.66264 WP_001295356.1.66280 WP_001295356.1.66288 WP_001295356.1.66290 WP_001295356.1.66295 WP_001295356.1.66327 WP_001295356.1.66335 WP_001295356.1.6635 WP_001295356.1.66376 WP_001295356.1.66387 WP_001295356.1.66389 WP_001295356.1.66392 WP_001295356.1.66395 WP_001295356.1.66412 WP_001295356.1.66421 WP_001295356.1.66432 WP_001295356.1.66448 WP_001295356.1.66501 WP_001295356.1.66511 WP_001295356.1.66523 WP_001295356.1.66531 WP_001295356.1.6654 WP_001295356.1.66550 WP_001295356.1.66559 WP_001295356.1.66566 WP_001295356.1.66579 WP_001295356.1.66624 WP_001295356.1.66644 WP_001295356.1.6665 WP_001295356.1.6666 WP_001295356.1.66667 WP_001295356.1.66668 WP_001295356.1.66700 WP_001295356.1.66706 WP_001295356.1.66708 WP_001295356.1.66719 WP_001295356.1.66727 WP_001295356.1.66751 WP_001295356.1.66758 WP_001295356.1.6676 WP_001295356.1.66783 WP_001295356.1.66787 WP_001295356.1.66791 WP_001295356.1.66794 WP_001295356.1.66795 WP_001295356.1.66796 WP_001295356.1.66849 WP_001295356.1.66873 WP_001295356.1.66922 WP_001295356.1.66926 WP_001295356.1.66933 WP_001295356.1.66948 WP_001295356.1.66975 WP_001295356.1.66978 WP_001295356.1.6698 WP_001295356.1.66984 WP_001295356.1.6701 WP_001295356.1.67018 WP_001295356.1.67021 WP_001295356.1.67022 WP_001295356.1.67026 WP_001295356.1.67029 WP_001295356.1.67035 WP_001295356.1.67047 WP_001295356.1.67055 WP_001295356.1.6706 WP_001295356.1.67073 WP_001295356.1.67102 WP_001295356.1.67116 WP_001295356.1.67120 WP_001295356.1.67132 WP_001295356.1.67136 WP_001295356.1.67137 WP_001295356.1.67149 WP_001295356.1.67150 WP_001295356.1.67153 WP_001295356.1.67158 WP_001295356.1.67164 WP_001295356.1.67174 WP_001295356.1.67193 WP_001295356.1.67194 WP_001295356.1.67200 WP_001295356.1.67209 WP_001295356.1.67210 WP_001295356.1.67214 WP_001295356.1.6723 WP_001295356.1.67258 WP_001295356.1.67272 WP_001295356.1.67278 WP_001295356.1.67284 WP_001295356.1.67293 WP_001295356.1.6735 WP_001295356.1.67373 WP_001295356.1.67383 WP_001295356.1.67412 WP_001295356.1.67415 WP_001295356.1.67427 WP_001295356.1.67446 WP_001295356.1.67451 WP_001295356.1.67452 WP_001295356.1.67454 WP_001295356.1.67456 WP_001295356.1.67462 WP_001295356.1.67464 WP_001295356.1.67467 WP_001295356.1.67468 WP_001295356.1.67495 WP_001295356.1.67522 WP_001295356.1.67533 WP_001295356.1.67538 WP_001295356.1.67549 WP_001295356.1.67553 WP_001295356.1.67581 WP_001295356.1.67590 WP_001295356.1.67606 WP_001295356.1.67660 WP_001295356.1.67663 WP_001295356.1.67669 WP_001295356.1.67676 WP_001295356.1.67681 WP_001295356.1.67685 WP_001295356.1.6769 WP_001295356.1.67690 WP_001295356.1.67701 WP_001295356.1.67704 WP_001295356.1.67724 WP_001295356.1.67726 WP_001295356.1.67732 WP_001295356.1.67737 WP_001295356.1.67753 WP_001295356.1.67758 WP_001295356.1.67760 WP_001295356.1.67775 WP_001295356.1.67780 WP_001295356.1.67786 WP_001295356.1.67787 WP_001295356.1.67788 WP_001295356.1.678 WP_001295356.1.67802 WP_001295356.1.67810 WP_001295356.1.67841 WP_001295356.1.67853 WP_001295356.1.67861 WP_001295356.1.67891 WP_001295356.1.67894 WP_001295356.1.67901 WP_001295356.1.6793 WP_001295356.1.67938 WP_001295356.1.67971 WP_001295356.1.67975 WP_001295356.1.67984 WP_001295356.1.67990 WP_001295356.1.67992 WP_001295356.1.67999 WP_001295356.1.68008 WP_001295356.1.68011 WP_001295356.1.68012 WP_001295356.1.6802 WP_001295356.1.68025 WP_001295356.1.6803 WP_001295356.1.68039 WP_001295356.1.68052 WP_001295356.1.68053 WP_001295356.1.68058 WP_001295356.1.68059 WP_001295356.1.68063 WP_001295356.1.68067 WP_001295356.1.68069 WP_001295356.1.68070 WP_001295356.1.68071 WP_001295356.1.68079 WP_001295356.1.68096 WP_001295356.1.6810 WP_001295356.1.68108 WP_001295356.1.68126 WP_001295356.1.68138 WP_001295356.1.6814 WP_001295356.1.68145 WP_001295356.1.68157 WP_001295356.1.68170 WP_001295356.1.68175 WP_001295356.1.68177 WP_001295356.1.682 WP_001295356.1.68200 WP_001295356.1.68215 WP_001295356.1.68231 WP_001295356.1.68241 WP_001295356.1.68255 WP_001295356.1.68271 WP_001295356.1.68278 WP_001295356.1.68279 WP_001295356.1.68281 WP_001295356.1.68283 WP_001295356.1.68292 WP_001295356.1.68300 WP_001295356.1.68336 WP_001295356.1.68341 WP_001295356.1.68347 WP_001295356.1.68362 WP_001295356.1.68369 WP_001295356.1.68372 WP_001295356.1.68395 WP_001295356.1.68396 WP_001295356.1.68411 WP_001295356.1.68441 WP_001295356.1.68442 WP_001295356.1.68482 WP_001295356.1.68490 WP_001295356.1.68493 WP_001295356.1.68523 WP_001295356.1.68524 WP_001295356.1.68534 WP_001295356.1.68566 WP_001295356.1.68572 WP_001295356.1.68584 WP_001295356.1.6859 WP_001295356.1.68598 WP_001295356.1.6860 WP_001295356.1.68609 WP_001295356.1.68630 WP_001295356.1.68632 WP_001295356.1.68635 WP_001295356.1.68673 WP_001295356.1.68678 WP_001295356.1.68679 WP_001295356.1.68695 WP_001295356.1.68697 WP_001295356.1.68701 WP_001295356.1.68711 WP_001295356.1.68731 WP_001295356.1.68735 WP_001295356.1.68750 WP_001295356.1.68751 WP_001295356.1.68752 WP_001295356.1.6877 WP_001295356.1.68793 WP_001295356.1.68795 WP_001295356.1.68797 WP_001295356.1.6880 WP_001295356.1.68801 WP_001295356.1.68838 WP_001295356.1.68847 WP_001295356.1.68865 WP_001295356.1.6887 WP_001295356.1.68873 WP_001295356.1.68877 WP_001295356.1.68880 WP_001295356.1.68911 WP_001295356.1.68915 WP_001295356.1.6892 WP_001295356.1.68924 WP_001295356.1.68936 WP_001295356.1.68942 WP_001295356.1.68952 WP_001295356.1.68956 WP_001295356.1.68961 WP_001295356.1.6897 WP_001295356.1.68989 WP_001295356.1.68995 WP_001295356.1.69033 WP_001295356.1.69039 WP_001295356.1.69054 WP_001295356.1.69098 WP_001295356.1.69127 WP_001295356.1.69144 WP_001295356.1.69158 WP_001295356.1.6916 WP_001295356.1.69160 WP_001295356.1.6919 WP_001295356.1.69192 WP_001295356.1.6921 WP_001295356.1.69221 WP_001295356.1.6923 WP_001295356.1.69247 WP_001295356.1.69258 WP_001295356.1.69261 WP_001295356.1.6929 WP_001295356.1.69303 WP_001295356.1.69305 WP_001295356.1.69327 WP_001295356.1.69341 WP_001295356.1.69350 WP_001295356.1.69351 WP_001295356.1.69382 WP_001295356.1.69390 WP_001295356.1.694 WP_001295356.1.69404 WP_001295356.1.69438 WP_001295356.1.69441 WP_001295356.1.6945 WP_001295356.1.69450 WP_001295356.1.69472 WP_001295356.1.69473 WP_001295356.1.69502 WP_001295356.1.69537 WP_001295356.1.69551 WP_001295356.1.69569 WP_001295356.1.69583 WP_001295356.1.69593 WP_001295356.1.69605 WP_001295356.1.69643 WP_001295356.1.69646 WP_001295356.1.69649 WP_001295356.1.69655 WP_001295356.1.69689 WP_001295356.1.697 WP_001295356.1.69716 WP_001295356.1.69730 WP_001295356.1.69735 WP_001295356.1.69780 WP_001295356.1.69786 WP_001295356.1.69803 WP_001295356.1.69810 WP_001295356.1.69818 WP_001295356.1.69831 WP_001295356.1.69832 WP_001295356.1.69868 WP_001295356.1.69872 WP_001295356.1.69887 WP_001295356.1.69896 WP_001295356.1.6993 WP_001295356.1.69963 WP_001295356.1.69972 WP_001295356.1.69979 WP_001295356.1.69999 WP_001295356.1.7001 WP_001295356.1.70041 WP_001295356.1.70063 WP_001295356.1.70081 WP_001295356.1.701 WP_001295356.1.70123 WP_001295356.1.70125 WP_001295356.1.7013 WP_001295356.1.70149 WP_001295356.1.7015 WP_001295356.1.70190 WP_001295356.1.70191 WP_001295356.1.70200 WP_001295356.1.70213 WP_001295356.1.70230 WP_001295356.1.70251 WP_001295356.1.70256 WP_001295356.1.70264 WP_001295356.1.70299 WP_001295356.1.70300 WP_001295356.1.70341 WP_001295356.1.70357 WP_001295356.1.70370 WP_001295356.1.70386 WP_001295356.1.70407 WP_001295356.1.70408 WP_001295356.1.70414 WP_001295356.1.70477 WP_001295356.1.70492 WP_001295356.1.7050 WP_001295356.1.70509 WP_001295356.1.70517 WP_001295356.1.7052 WP_001295356.1.70530 WP_001295356.1.70539 WP_001295356.1.70563 WP_001295356.1.70576 WP_001295356.1.70578 WP_001295356.1.70582 WP_001295356.1.70592 WP_001295356.1.70597 WP_001295356.1.70600 WP_001295356.1.70619 WP_001295356.1.70628 WP_001295356.1.70655 WP_001295356.1.70656 WP_001295356.1.70686 WP_001295356.1.70694 WP_001295356.1.70698 WP_001295356.1.70705 WP_001295356.1.70713 WP_001295356.1.70723 WP_001295356.1.70728 WP_001295356.1.70745 WP_001295356.1.70747 WP_001295356.1.70748 WP_001295356.1.70767 WP_001295356.1.70787 WP_001295356.1.70794 WP_001295356.1.70801 WP_001295356.1.70880 WP_001295356.1.70896 WP_001295356.1.7090 WP_001295356.1.70900 WP_001295356.1.70952 WP_001295356.1.70967 WP_001295356.1.71003 WP_001295356.1.7102 WP_001295356.1.71024 WP_001295356.1.71037 WP_001295356.1.71042 WP_001295356.1.71062 WP_001295356.1.71099 WP_001295356.1.71109 WP_001295356.1.71113 WP_001295356.1.71134 WP_001295356.1.71139 WP_001295356.1.71144 WP_001295356.1.71147 WP_001295356.1.71149 WP_001295356.1.71158 WP_001295356.1.71159 WP_001295356.1.71162 WP_001295356.1.71170 WP_001295356.1.71176 WP_001295356.1.71183 WP_001295356.1.71192 WP_001295356.1.71199 WP_001295356.1.71205 WP_001295356.1.7121 WP_001295356.1.71221 WP_001295356.1.71223 WP_001295356.1.71225 WP_001295356.1.71226 WP_001295356.1.71229 WP_001295356.1.71264 WP_001295356.1.71269 WP_001295356.1.71272 WP_001295356.1.71273 WP_001295356.1.71275 WP_001295356.1.71285 WP_001295356.1.71287 WP_001295356.1.71294 WP_001295356.1.71311 WP_001295356.1.71312 WP_001295356.1.71315 WP_001295356.1.71323 WP_001295356.1.71327 WP_001295356.1.71339 WP_001295356.1.71354 WP_001295356.1.71397 WP_001295356.1.71403 WP_001295356.1.71405 WP_001295356.1.71409 WP_001295356.1.71421 WP_001295356.1.71423 WP_001295356.1.71448 WP_001295356.1.7147 WP_001295356.1.71480 WP_001295356.1.71522 WP_001295356.1.71533 WP_001295356.1.71537 WP_001295356.1.71538 WP_001295356.1.71540 WP_001295356.1.71560 WP_001295356.1.71562 WP_001295356.1.71563 WP_001295356.1.71603 WP_001295356.1.71607 WP_001295356.1.71632 WP_001295356.1.71680 WP_001295356.1.71690 WP_001295356.1.71695 WP_001295356.1.71712 WP_001295356.1.71724 WP_001295356.1.71732 WP_001295356.1.71757 WP_001295356.1.71767 WP_001295356.1.71783 WP_001295356.1.71830 WP_001295356.1.71832 WP_001295356.1.71837 WP_001295356.1.71840 WP_001295356.1.71855 WP_001295356.1.71856 WP_001295356.1.71874 WP_001295356.1.71912 WP_001295356.1.7192 WP_001295356.1.71922 WP_001295356.1.71938 WP_001295356.1.71939 WP_001295356.1.71940 WP_001295356.1.71944 WP_001295356.1.71945 WP_001295356.1.71967 WP_001295356.1.71972 WP_001295356.1.71975 WP_001295356.1.71987 WP_001295356.1.71993 WP_001295356.1.71995 WP_001295356.1.72013 WP_001295356.1.72016 WP_001295356.1.72021 WP_001295356.1.72028 WP_001295356.1.72033 WP_001295356.1.72048 WP_001295356.1.7205 WP_001295356.1.72053 WP_001295356.1.72054 WP_001295356.1.72066 WP_001295356.1.72090 WP_001295356.1.72098 WP_001295356.1.7210 WP_001295356.1.72117 WP_001295356.1.72120 WP_001295356.1.72125 WP_001295356.1.72126 WP_001295356.1.72141 WP_001295356.1.72153 WP_001295356.1.72155 WP_001295356.1.72157 WP_001295356.1.72161 WP_001295356.1.72162 WP_001295356.1.72180 WP_001295356.1.72184 WP_001295356.1.72186 WP_001295356.1.72208 WP_001295356.1.72212 WP_001295356.1.72237 WP_001295356.1.72240 WP_001295356.1.72248 WP_001295356.1.7225 WP_001295356.1.72258 WP_001295356.1.72261 WP_001295356.1.72262 WP_001295356.1.72270 WP_001295356.1.72279 WP_001295356.1.72290 WP_001295356.1.72293 WP_001295356.1.72298 WP_001295356.1.723 WP_001295356.1.72316 WP_001295356.1.72322 WP_001295356.1.72337 WP_001295356.1.72342 WP_001295356.1.72352 WP_001295356.1.72359 WP_001295356.1.72362 WP_001295356.1.72388 WP_001295356.1.72391 WP_001295356.1.72392 WP_001295356.1.72397 WP_001295356.1.72414 WP_001295356.1.72425 WP_001295356.1.72427 WP_001295356.1.72431 WP_001295356.1.72436 WP_001295356.1.72449 WP_001295356.1.72469 WP_001295356.1.72485 WP_001295356.1.72493 WP_001295356.1.72507 WP_001295356.1.72511 WP_001295356.1.72521 WP_001295356.1.72522 WP_001295356.1.72535 WP_001295356.1.72537 WP_001295356.1.72544 WP_001295356.1.72574 WP_001295356.1.72582 WP_001295356.1.72588 WP_001295356.1.72593 WP_001295356.1.72596 WP_001295356.1.72599 WP_001295356.1.72606 WP_001295356.1.72608 WP_001295356.1.72614 WP_001295356.1.72615 WP_001295356.1.72616 WP_001295356.1.72619 WP_001295356.1.72641 WP_001295356.1.72643 WP_001295356.1.72651 WP_001295356.1.72652 WP_001295356.1.72663 WP_001295356.1.72694 WP_001295356.1.72695 WP_001295356.1.72698 WP_001295356.1.72700 WP_001295356.1.72706 WP_001295356.1.72725 WP_001295356.1.72729 WP_001295356.1.72738 WP_001295356.1.72745 WP_001295356.1.72747 WP_001295356.1.72748 WP_001295356.1.72751 WP_001295356.1.72758 WP_001295356.1.7277 WP_001295356.1.72778 WP_001295356.1.72804 WP_001295356.1.72806 WP_001295356.1.7281 WP_001295356.1.72857 WP_001295356.1.72858 WP_001295356.1.72860 WP_001295356.1.72869 WP_001295356.1.72893 WP_001295356.1.7291 WP_001295356.1.72910 WP_001295356.1.72913 WP_001295356.1.72947 WP_001295356.1.72950 WP_001295356.1.72956 WP_001295356.1.72962 WP_001295356.1.72998 WP_001295356.1.73000 WP_001295356.1.73010 WP_001295356.1.73015 WP_001295356.1.73032 WP_001295356.1.73039 WP_001295356.1.73061 WP_001295356.1.7307 WP_001295356.1.73072 WP_001295356.1.73075 WP_001295356.1.73085 WP_001295356.1.7309 WP_001295356.1.73094 WP_001295356.1.73126 WP_001295356.1.73129 WP_001295356.1.73193 WP_001295356.1.73197 WP_001295356.1.73215 WP_001295356.1.73217 WP_001295356.1.73230 WP_001295356.1.73239 WP_001295356.1.73243 WP_001295356.1.73249 WP_001295356.1.73257 WP_001295356.1.73259 WP_001295356.1.73277 WP_001295356.1.73278 WP_001295356.1.73283 WP_001295356.1.73291 WP_001295356.1.73292 WP_001295356.1.73295 WP_001295356.1.73326 WP_001295356.1.73333 WP_001295356.1.73340 WP_001295356.1.73343 WP_001295356.1.73344 WP_001295356.1.73349 WP_001295356.1.73385 WP_001295356.1.73393 WP_001295356.1.73428 WP_001295356.1.73430 WP_001295356.1.7345 WP_001295356.1.73468 WP_001295356.1.73486 WP_001295356.1.7349 WP_001295356.1.73498 WP_001295356.1.73524 WP_001295356.1.73565 WP_001295356.1.73572 WP_001295356.1.73592 WP_001295356.1.73604 WP_001295356.1.73626 WP_001295356.1.73631 WP_001295356.1.73652 WP_001295356.1.73663 WP_001295356.1.73700 WP_001295356.1.73709 WP_001295356.1.73717 WP_001295356.1.73743 WP_001295356.1.73748 WP_001295356.1.7376 WP_001295356.1.73783 WP_001295356.1.73785 WP_001295356.1.73797 WP_001295356.1.73801 WP_001295356.1.73807 WP_001295356.1.73811 WP_001295356.1.73827 WP_001295356.1.73835 WP_001295356.1.73843 WP_001295356.1.73844 WP_001295356.1.73846 WP_001295356.1.73859 WP_001295356.1.73882 WP_001295356.1.73908 WP_001295356.1.7392 WP_001295356.1.73934 WP_001295356.1.73942 WP_001295356.1.73968 WP_001295356.1.73980 WP_001295356.1.73992 WP_001295356.1.73995 WP_001295356.1.74032 WP_001295356.1.74041 WP_001295356.1.74045 WP_001295356.1.74046 WP_001295356.1.74051 WP_001295356.1.74053 WP_001295356.1.7407 WP_001295356.1.7411 WP_001295356.1.74123 WP_001295356.1.7413 WP_001295356.1.74156 WP_001295356.1.74184 WP_001295356.1.74185 WP_001295356.1.74213 WP_001295356.1.74223 WP_001295356.1.7424 WP_001295356.1.74243 WP_001295356.1.7425 WP_001295356.1.74251 WP_001295356.1.74267 WP_001295356.1.7429 WP_001295356.1.74294 WP_001295356.1.74309 WP_001295356.1.74358 WP_001295356.1.74365 WP_001295356.1.74367 WP_001295356.1.744 WP_001295356.1.74423 WP_001295356.1.74426 WP_001295356.1.74431 WP_001295356.1.74444 WP_001295356.1.74445 WP_001295356.1.7446 WP_001295356.1.74465 WP_001295356.1.74478 WP_001295356.1.74491 WP_001295356.1.74501 WP_001295356.1.74509 WP_001295356.1.74513 WP_001295356.1.74520 WP_001295356.1.74521 WP_001295356.1.74528 WP_001295356.1.74532 WP_001295356.1.74536 WP_001295356.1.74549 WP_001295356.1.74557 WP_001295356.1.74574 WP_001295356.1.7461 WP_001295356.1.74611 WP_001295356.1.74623 WP_001295356.1.74624 WP_001295356.1.74625 WP_001295356.1.74631 WP_001295356.1.74652 WP_001295356.1.74670 WP_001295356.1.74682 WP_001295356.1.74687 WP_001295356.1.74688 WP_001295356.1.74689 WP_001295356.1.74691 WP_001295356.1.74705 WP_001295356.1.7471 WP_001295356.1.74713 WP_001295356.1.74716 WP_001295356.1.74720 WP_001295356.1.74735 WP_001295356.1.7475 WP_001295356.1.74752 WP_001295356.1.74765 WP_001295356.1.74767 WP_001295356.1.7478 WP_001295356.1.7479 WP_001295356.1.74793 WP_001295356.1.74811 WP_001295356.1.74828 WP_001295356.1.74844 WP_001295356.1.74852 WP_001295356.1.74854 WP_001295356.1.74860 WP_001295356.1.74867 WP_001295356.1.74873 WP_001295356.1.74879 WP_001295356.1.74880 WP_001295356.1.74885 WP_001295356.1.74889 WP_001295356.1.74895 WP_001295356.1.74904 WP_001295356.1.74914 WP_001295356.1.74915 WP_001295356.1.74962 WP_001295356.1.74975 WP_001295356.1.74993 WP_001295356.1.74998 WP_001295356.1.75003 WP_001295356.1.75021 WP_001295356.1.75030 WP_001295356.1.75050 WP_001295356.1.75087 WP_001295356.1.75100 WP_001295356.1.75112 WP_001295356.1.75118 WP_001295356.1.75124 WP_001295356.1.75136 WP_001295356.1.75138 WP_001295356.1.75139 WP_001295356.1.75143 WP_001295356.1.75145 WP_001295356.1.75149 WP_001295356.1.75155 WP_001295356.1.7516 WP_001295356.1.75164 WP_001295356.1.75181 WP_001295356.1.75209 WP_001295356.1.75218 WP_001295356.1.75219 WP_001295356.1.75221 WP_001295356.1.75228 WP_001295356.1.75243 WP_001295356.1.75247 WP_001295356.1.75248 WP_001295356.1.75254 WP_001295356.1.75272 WP_001295356.1.75306 WP_001295356.1.7536 WP_001295356.1.75360 WP_001295356.1.75367 WP_001295356.1.75382 WP_001295356.1.7539 WP_001295356.1.75419 WP_001295356.1.75428 WP_001295356.1.75435 WP_001295356.1.75465 WP_001295356.1.75491 WP_001295356.1.75505 WP_001295356.1.75507 WP_001295356.1.75515 WP_001295356.1.75529 WP_001295356.1.75536 WP_001295356.1.75537 WP_001295356.1.75557 WP_001295356.1.75568 WP_001295356.1.75577 WP_001295356.1.75588 WP_001295356.1.75594 WP_001295356.1.75602 WP_001295356.1.75612 WP_001295356.1.75629 WP_001295356.1.75644 WP_001295356.1.75653 WP_001295356.1.75672 WP_001295356.1.75676 WP_001295356.1.75679 WP_001295356.1.75687 WP_001295356.1.75694 WP_001295356.1.75696 WP_001295356.1.75698 WP_001295356.1.75699 WP_001295356.1.75725 WP_001295356.1.75735 WP_001295356.1.75758 WP_001295356.1.75767 WP_001295356.1.75786 WP_001295356.1.75803 WP_001295356.1.75808 WP_001295356.1.7583 WP_001295356.1.75839 WP_001295356.1.75853 WP_001295356.1.75892 WP_001295356.1.75918 WP_001295356.1.75922 WP_001295356.1.7597 WP_001295356.1.75973 WP_001295356.1.75983 WP_001295356.1.75989 WP_001295356.1.75995 WP_001295356.1.75999 WP_001295356.1.76005 WP_001295356.1.76019 WP_001295356.1.7603 WP_001295356.1.76030 WP_001295356.1.76036 WP_001295356.1.76054 WP_001295356.1.76057 WP_001295356.1.7608 WP_001295356.1.76087 WP_001295356.1.76089 WP_001295356.1.76103 WP_001295356.1.76118 WP_001295356.1.76119 WP_001295356.1.76129 WP_001295356.1.7613 WP_001295356.1.76152 WP_001295356.1.7617 WP_001295356.1.76184 WP_001295356.1.76189 WP_001295356.1.76194 WP_001295356.1.76196 WP_001295356.1.76211 WP_001295356.1.76237 WP_001295356.1.76268 WP_001295356.1.76269 WP_001295356.1.76305 WP_001295356.1.76312 WP_001295356.1.76325 WP_001295356.1.76335 WP_001295356.1.76361 WP_001295356.1.7637 WP_001295356.1.76376 WP_001295356.1.76384 WP_001295356.1.76387 WP_001295356.1.76390 WP_001295356.1.76407 WP_001295356.1.76446 WP_001295356.1.76447 WP_001295356.1.76448 WP_001295356.1.76452 WP_001295356.1.76460 WP_001295356.1.76462 WP_001295356.1.76466 WP_001295356.1.76469 WP_001295356.1.76477 WP_001295356.1.76504 WP_001295356.1.76542 WP_001295356.1.76544 WP_001295356.1.76547 WP_001295356.1.76562 WP_001295356.1.76595 WP_001295356.1.76596 WP_001295356.1.7661 WP_001295356.1.76612 WP_001295356.1.76619 WP_001295356.1.76643 WP_001295356.1.76656 WP_001295356.1.76660 WP_001295356.1.76697 WP_001295356.1.76701 WP_001295356.1.76705 WP_001295356.1.76707 WP_001295356.1.76712 WP_001295356.1.76751 WP_001295356.1.76759 WP_001295356.1.7680 WP_001295356.1.76815 WP_001295356.1.76827 WP_001295356.1.76831 WP_001295356.1.76840 WP_001295356.1.76863 WP_001295356.1.76884 WP_001295356.1.7689 WP_001295356.1.76909 WP_001295356.1.76918 WP_001295356.1.76933 WP_001295356.1.76948 WP_001295356.1.76957 WP_001295356.1.76961 WP_001295356.1.76965 WP_001295356.1.76966 WP_001295356.1.7699 WP_001295356.1.76994 WP_001295356.1.77007 WP_001295356.1.77015 WP_001295356.1.77022 WP_001295356.1.77036 WP_001295356.1.77042 WP_001295356.1.77057 WP_001295356.1.77070 WP_001295356.1.77081 WP_001295356.1.77099 WP_001295356.1.771 WP_001295356.1.77109 WP_001295356.1.77120 WP_001295356.1.77128 WP_001295356.1.77134 WP_001295356.1.77147 WP_001295356.1.77162 WP_001295356.1.77163 WP_001295356.1.77173 WP_001295356.1.77175 WP_001295356.1.77198 WP_001295356.1.77200 WP_001295356.1.77204 WP_001295356.1.77214 WP_001295356.1.77224 WP_001295356.1.77239 WP_001295356.1.77253 WP_001295356.1.77258 WP_001295356.1.77275 WP_001295356.1.7728 WP_001295356.1.77284 WP_001295356.1.77288 WP_001295356.1.7729 WP_001295356.1.77290 WP_001295356.1.77291 WP_001295356.1.77296 WP_001295356.1.7731 WP_001295356.1.77320 WP_001295356.1.77341 WP_001295356.1.77358 WP_001295356.1.77391 WP_001295356.1.77392 WP_001295356.1.77408 WP_001295356.1.77419 WP_001295356.1.77432 WP_001295356.1.77437 WP_001295356.1.77448 WP_001295356.1.77452 WP_001295356.1.77455 WP_001295356.1.77462 WP_001295356.1.7747 WP_001295356.1.77470 WP_001295356.1.77471 WP_001295356.1.77477 WP_001295356.1.77481 WP_001295356.1.77487 WP_001295356.1.77495 WP_001295356.1.775 WP_001295356.1.7750 WP_001295356.1.77503 WP_001295356.1.77511 WP_001295356.1.77542 WP_001295356.1.77551 WP_001295356.1.7756 WP_001295356.1.77577 WP_001295356.1.77581 WP_001295356.1.77595 WP_001295356.1.77600 WP_001295356.1.77608 WP_001295356.1.77626 WP_001295356.1.77632 WP_001295356.1.77636 WP_001295356.1.77643 WP_001295356.1.77644 WP_001295356.1.77648 WP_001295356.1.77657 WP_001295356.1.77707 WP_001295356.1.77725 WP_001295356.1.77741 WP_001295356.1.7775 WP_001295356.1.77760 WP_001295356.1.77767 WP_001295356.1.77768 WP_001295356.1.7780 WP_001295356.1.7781 WP_001295356.1.77813 WP_001295356.1.77816 WP_001295356.1.77826 WP_001295356.1.77833 WP_001295356.1.77876 WP_001295356.1.77929 WP_001295356.1.77949 WP_001295356.1.7795 WP_001295356.1.77950 WP_001295356.1.77961 WP_001295356.1.77979 WP_001295356.1.7799 WP_001295356.1.77999 WP_001295356.1.78000 WP_001295356.1.78007 WP_001295356.1.78010 WP_001295356.1.7804 WP_001295356.1.78041 WP_001295356.1.78059 WP_001295356.1.7806 WP_001295356.1.78063 WP_001295356.1.7808 WP_001295356.1.78089 WP_001295356.1.78097 WP_001295356.1.78099 WP_001295356.1.78101 WP_001295356.1.78102 WP_001295356.1.78131 WP_001295356.1.78183 WP_001295356.1.78187 WP_001295356.1.78188 WP_001295356.1.78196 WP_001295356.1.78202 WP_001295356.1.78232 WP_001295356.1.78233 WP_001295356.1.78235 WP_001295356.1.78297 WP_001295356.1.78305 WP_001295356.1.78321 WP_001295356.1.78323 WP_001295356.1.78337 WP_001295356.1.78340 WP_001295356.1.78368 WP_001295356.1.78376 WP_001295356.1.78377 WP_001295356.1.78390 WP_001295356.1.784 WP_001295356.1.78413 WP_001295356.1.78445 WP_001295356.1.78453 WP_001295356.1.78462 WP_001295356.1.78463 WP_001295356.1.7847 WP_001295356.1.78477 WP_001295356.1.78481 WP_001295356.1.78491 WP_001295356.1.7851 WP_001295356.1.78512 WP_001295356.1.78523 WP_001295356.1.78527 WP_001295356.1.7855 WP_001295356.1.78553 WP_001295356.1.78572 WP_001295356.1.78575 WP_001295356.1.78581 WP_001295356.1.78583 WP_001295356.1.78586 WP_001295356.1.78593 WP_001295356.1.78610 WP_001295356.1.78611 WP_001295356.1.78612 WP_001295356.1.78615 WP_001295356.1.78622 WP_001295356.1.78645 WP_001295356.1.78677 WP_001295356.1.78683 WP_001295356.1.78687 WP_001295356.1.78689 WP_001295356.1.78696 WP_001295356.1.78698 WP_001295356.1.78706 WP_001295356.1.78714 WP_001295356.1.78718 WP_001295356.1.78746 WP_001295356.1.78750 WP_001295356.1.78757 WP_001295356.1.78773 WP_001295356.1.78775 WP_001295356.1.78791 WP_001295356.1.78814 WP_001295356.1.7883 WP_001295356.1.78843 WP_001295356.1.78845 WP_001295356.1.78854 WP_001295356.1.78888 WP_001295356.1.78891 WP_001295356.1.78893 WP_001295356.1.78895 WP_001295356.1.78908 WP_001295356.1.78919 WP_001295356.1.78953 WP_001295356.1.78955 WP_001295356.1.78956 WP_001295356.1.7896 WP_001295356.1.78966 WP_001295356.1.7898 WP_001295356.1.78996 WP_001295356.1.79001 WP_001295356.1.79002 WP_001295356.1.79004 WP_001295356.1.79065 WP_001295356.1.79067 WP_001295356.1.79075 WP_001295356.1.79086 WP_001295356.1.79088 WP_001295356.1.79090 WP_001295356.1.79092 WP_001295356.1.79100 WP_001295356.1.79126 WP_001295356.1.79137 WP_001295356.1.79159 WP_001295356.1.79172 WP_001295356.1.79226 WP_001295356.1.79233 WP_001295356.1.79243 WP_001295356.1.79246 WP_001295356.1.79248 WP_001295356.1.79249 WP_001295356.1.79276 WP_001295356.1.79306 WP_001295356.1.79308 WP_001295356.1.79312 WP_001295356.1.79342 WP_001295356.1.79343 WP_001295356.1.79346 WP_001295356.1.79348 WP_001295356.1.79356 WP_001295356.1.79365 WP_001295356.1.79368 WP_001295356.1.7937 WP_001295356.1.79389 WP_001295356.1.79391 WP_001295356.1.7940 WP_001295356.1.79409 WP_001295356.1.79414 WP_001295356.1.79416 WP_001295356.1.79443 WP_001295356.1.79464 WP_001295356.1.79478 WP_001295356.1.79505 WP_001295356.1.7952 WP_001295356.1.79525 WP_001295356.1.79526 WP_001295356.1.79528 WP_001295356.1.79540 WP_001295356.1.79558 WP_001295356.1.79563 WP_001295356.1.79576 WP_001295356.1.79591 WP_001295356.1.79606 WP_001295356.1.79619 WP_001295356.1.79640 WP_001295356.1.7967 WP_001295356.1.79685 WP_001295356.1.79707 WP_001295356.1.79713 WP_001295356.1.79715 WP_001295356.1.79749 WP_001295356.1.79759 WP_001295356.1.79764 WP_001295356.1.79800 WP_001295356.1.79816 WP_001295356.1.79824 WP_001295356.1.79840 WP_001295356.1.7985 WP_001295356.1.79866 WP_001295356.1.79869 WP_001295356.1.7987 WP_001295356.1.79871 WP_001295356.1.79877 WP_001295356.1.79905 WP_001295356.1.79922 WP_001295356.1.7993 WP_001295356.1.79930 WP_001295356.1.79931 WP_001295356.1.79932 WP_001295356.1.79933 WP_001295356.1.79936 WP_001295356.1.79944 WP_001295356.1.79952 WP_001295356.1.79955 WP_001295356.1.79965 WP_001295356.1.79973 WP_001295356.1.79984 WP_001295356.1.79995 WP_001295356.1.80 WP_001295356.1.80011 WP_001295356.1.80016 WP_001295356.1.80026 WP_001295356.1.8004 WP_001295356.1.80043 WP_001295356.1.80050 WP_001295356.1.80060 WP_001295356.1.80061 WP_001295356.1.80063 WP_001295356.1.80071 WP_001295356.1.80096 WP_001295356.1.80106 WP_001295356.1.8011 WP_001295356.1.80112 WP_001295356.1.80136 WP_001295356.1.80141 WP_001295356.1.80168 WP_001295356.1.80176 WP_001295356.1.80183 WP_001295356.1.80192 WP_001295356.1.80255 WP_001295356.1.80292 WP_001295356.1.80309 WP_001295356.1.80310 WP_001295356.1.80320 WP_001295356.1.80330 WP_001295356.1.80343 WP_001295356.1.80388 WP_001295356.1.80392 WP_001295356.1.804 WP_001295356.1.80402 WP_001295356.1.80426 WP_001295356.1.80428 WP_001295356.1.80440 WP_001295356.1.80444 WP_001295356.1.80456 WP_001295356.1.80463 WP_001295356.1.80484 WP_001295356.1.80517 WP_001295356.1.80519 WP_001295356.1.80524 WP_001295356.1.80545 WP_001295356.1.80558 WP_001295356.1.80559 WP_001295356.1.8057 WP_001295356.1.80577 WP_001295356.1.80578 WP_001295356.1.80594 WP_001295356.1.80606 WP_001295356.1.80612 WP_001295356.1.80626 WP_001295356.1.80660 WP_001295356.1.80662 WP_001295356.1.80666 WP_001295356.1.80676 WP_001295356.1.8068 WP_001295356.1.80709 WP_001295356.1.80718 WP_001295356.1.80731 WP_001295356.1.80736 WP_001295356.1.80737 WP_001295356.1.8074 WP_001295356.1.80753 WP_001295356.1.80754 WP_001295356.1.80756 WP_001295356.1.8076 WP_001295356.1.80768 WP_001295356.1.80789 WP_001295356.1.808 WP_001295356.1.80804 WP_001295356.1.80805 WP_001295356.1.80843 WP_001295356.1.80862 WP_001295356.1.80882 WP_001295356.1.80884 WP_001295356.1.80894 WP_001295356.1.8090 WP_001295356.1.8091 WP_001295356.1.80935 WP_001295356.1.80945 WP_001295356.1.80946 WP_001295356.1.80948 WP_001295356.1.80954 WP_001295356.1.80966 WP_001295356.1.80983 WP_001295356.1.80985 WP_001295356.1.810 WP_001295356.1.81026 WP_001295356.1.81032 WP_001295356.1.81034 WP_001295356.1.81036 WP_001295356.1.81054 WP_001295356.1.81056 WP_001295356.1.81070 WP_001295356.1.81071 WP_001295356.1.81098 WP_001295356.1.811 WP_001295356.1.81104 WP_001295356.1.81120 WP_001295356.1.81127 WP_001295356.1.81141 WP_001295356.1.81156 WP_001295356.1.81160 WP_001295356.1.81165 WP_001295356.1.8118 WP_001295356.1.81180 WP_001295356.1.81182 WP_001295356.1.81186 WP_001295356.1.8121 WP_001295356.1.81219 WP_001295356.1.81267 WP_001295356.1.81273 WP_001295356.1.81281 WP_001295356.1.81283 WP_001295356.1.81286 WP_001295356.1.8129 WP_001295356.1.81298 WP_001295356.1.81313 WP_001295356.1.81316 WP_001295356.1.81323 WP_001295356.1.81347 WP_001295356.1.81376 WP_001295356.1.81391 WP_001295356.1.81396 WP_001295356.1.814 WP_001295356.1.81418 WP_001295356.1.81420 WP_001295356.1.81423 WP_001295356.1.81438 WP_001295356.1.81442 WP_001295356.1.81469 WP_001295356.1.81475 WP_001295356.1.81484 WP_001295356.1.81514 WP_001295356.1.81517 WP_001295356.1.8156 WP_001295356.1.81576 WP_001295356.1.81577 WP_001295356.1.81580 WP_001295356.1.81582 WP_001295356.1.81588 WP_001295356.1.81589 WP_001295356.1.81602 WP_001295356.1.81618 WP_001295356.1.81624 WP_001295356.1.81625 WP_001295356.1.81688 WP_001295356.1.81692 WP_001295356.1.81715 WP_001295356.1.8172 WP_001295356.1.81723 WP_001295356.1.81739 WP_001295356.1.81754 WP_001295356.1.81761 WP_001295356.1.81806 WP_001295356.1.81819 WP_001295356.1.81821 WP_001295356.1.8183 WP_001295356.1.81832 WP_001295356.1.81843 WP_001295356.1.81869 WP_001295356.1.81873 WP_001295356.1.81876 WP_001295356.1.81881 WP_001295356.1.81888 WP_001295356.1.81934 WP_001295356.1.81935 WP_001295356.1.81939 WP_001295356.1.81952 WP_001295356.1.81956 WP_001295356.1.81972 WP_001295356.1.81975 WP_001295356.1.82 WP_001295356.1.82008 WP_001295356.1.82010 WP_001295356.1.82032 WP_001295356.1.82057 WP_001295356.1.82059 WP_001295356.1.82061 WP_001295356.1.82062 WP_001295356.1.82074 WP_001295356.1.82095 WP_001295356.1.82104 WP_001295356.1.82106 WP_001295356.1.82116 WP_001295356.1.82123 WP_001295356.1.82137 WP_001295356.1.82166 WP_001295356.1.82217 WP_001295356.1.82221 WP_001295356.1.82239 WP_001295356.1.82240 WP_001295356.1.82242 WP_001295356.1.82246 WP_001295356.1.82275 WP_001295356.1.82280 WP_001295356.1.82296 WP_001295356.1.82316 WP_001295356.1.82320 WP_001295356.1.82330 WP_001295356.1.8235 WP_001295356.1.82378 WP_001295356.1.82438 WP_001295356.1.82439 WP_001295356.1.82485 WP_001295356.1.82499 WP_001295356.1.82507 WP_001295356.1.82514 WP_001295356.1.82527 WP_001295356.1.82536 WP_001295356.1.82539 WP_001295356.1.8255 WP_001295356.1.82572 WP_001295356.1.82589 WP_001295356.1.82594 WP_001295356.1.82614 WP_001295356.1.82626 WP_001295356.1.82629 WP_001295356.1.82647 WP_001295356.1.82661 WP_001295356.1.8268 WP_001295356.1.82682 WP_001295356.1.82691 WP_001295356.1.82698 WP_001295356.1.82700 WP_001295356.1.82705 WP_001295356.1.82711 WP_001295356.1.82715 WP_001295356.1.82718 WP_001295356.1.82747 WP_001295356.1.82754 WP_001295356.1.8277 WP_001295356.1.82776 WP_001295356.1.82780 WP_001295356.1.82784 WP_001295356.1.82797 WP_001295356.1.82799 WP_001295356.1.82808 WP_001295356.1.82816 WP_001295356.1.82820 WP_001295356.1.82831 WP_001295356.1.82833 WP_001295356.1.82853 WP_001295356.1.82901 WP_001295356.1.82902 WP_001295356.1.82923 WP_001295356.1.8295 WP_001295356.1.82991 WP_001295356.1.83020 WP_001295356.1.83033 WP_001295356.1.83036 WP_001295356.1.83051 WP_001295356.1.83059 WP_001295356.1.8306 WP_001295356.1.8308 WP_001295356.1.83093 WP_001295356.1.83097 WP_001295356.1.83099 WP_001295356.1.831 WP_001295356.1.83118 WP_001295356.1.83125 WP_001295356.1.83127 WP_001295356.1.83140 WP_001295356.1.83144 WP_001295356.1.83151 WP_001295356.1.83160 WP_001295356.1.83177 WP_001295356.1.83205 WP_001295356.1.83214 WP_001295356.1.83218 WP_001295356.1.83224 WP_001295356.1.83238 WP_001295356.1.83253 WP_001295356.1.83256 WP_001295356.1.83286 WP_001295356.1.83313 WP_001295356.1.83321 WP_001295356.1.83330 WP_001295356.1.83340 WP_001295356.1.83347 WP_001295356.1.83375 WP_001295356.1.83384 WP_001295356.1.83393 WP_001295356.1.83415 WP_001295356.1.8345 WP_001295356.1.83466 WP_001295356.1.83481 WP_001295356.1.83506 WP_001295356.1.83537 WP_001295356.1.83544 WP_001295356.1.83564 WP_001295356.1.83582 WP_001295356.1.83644 WP_001295356.1.83660 WP_001295356.1.83668 WP_001295356.1.8368 WP_001295356.1.83684 WP_001295356.1.83706 WP_001295356.1.83712 WP_001295356.1.83735 WP_001295356.1.83762 WP_001295356.1.83781 WP_001295356.1.83807 WP_001295356.1.83820 WP_001295356.1.8384 WP_001295356.1.8386 WP_001295356.1.83879 WP_001295356.1.83911 WP_001295356.1.83936 WP_001295356.1.83941 WP_001295356.1.83947 WP_001295356.1.84004 WP_001295356.1.84014 WP_001295356.1.84021 WP_001295356.1.8405 WP_001295356.1.84059 WP_001295356.1.84060 WP_001295356.1.84074 WP_001295356.1.8408 WP_001295356.1.8411 WP_001295356.1.84140 WP_001295356.1.84164 WP_001295356.1.84172 WP_001295356.1.84185 WP_001295356.1.84197 WP_001295356.1.84210 WP_001295356.1.84215 WP_001295356.1.84219 WP_001295356.1.84221 WP_001295356.1.84264 WP_001295356.1.84298 WP_001295356.1.84312 WP_001295356.1.84313 WP_001295356.1.84316 WP_001295356.1.84319 WP_001295356.1.84326 WP_001295356.1.84331 WP_001295356.1.84339 WP_001295356.1.84348 WP_001295356.1.84402 WP_001295356.1.84405 WP_001295356.1.84410 WP_001295356.1.84436 WP_001295356.1.8444 WP_001295356.1.84462 WP_001295356.1.84464 WP_001295356.1.84467 WP_001295356.1.8447 WP_001295356.1.84473 WP_001295356.1.84476 WP_001295356.1.84482 WP_001295356.1.84484 WP_001295356.1.84486 WP_001295356.1.84511 WP_001295356.1.84518 WP_001295356.1.84531 WP_001295356.1.84534 WP_001295356.1.84584 WP_001295356.1.84635 WP_001295356.1.84639 WP_001295356.1.84656 WP_001295356.1.84657 WP_001295356.1.84668 WP_001295356.1.84675 WP_001295356.1.84697 WP_001295356.1.8470 WP_001295356.1.84731 WP_001295356.1.84738 WP_001295356.1.84740 WP_001295356.1.84768 WP_001295356.1.8477 WP_001295356.1.84784 WP_001295356.1.84797 WP_001295356.1.84841 WP_001295356.1.84850 WP_001295356.1.84875 WP_001295356.1.84877 WP_001295356.1.84878 WP_001295356.1.84881 WP_001295356.1.84893 WP_001295356.1.84894 WP_001295356.1.84916 WP_001295356.1.84929 WP_001295356.1.84941 WP_001295356.1.84948 WP_001295356.1.84966 WP_001295356.1.84972 WP_001295356.1.84977 WP_001295356.1.84986 WP_001295356.1.84989 WP_001295356.1.84990 WP_001295356.1.84994 WP_001295356.1.85002 WP_001295356.1.85008 WP_001295356.1.85011 WP_001295356.1.85025 WP_001295356.1.85048 WP_001295356.1.85052 WP_001295356.1.85077 WP_001295356.1.85085 WP_001295356.1.85090 WP_001295356.1.85098 WP_001295356.1.85106 WP_001295356.1.85112 WP_001295356.1.85125 WP_001295356.1.85129 WP_001295356.1.85138 WP_001295356.1.85141 WP_001295356.1.85156 WP_001295356.1.8517 WP_001295356.1.85175 WP_001295356.1.85188 WP_001295356.1.85216 WP_001295356.1.85241 WP_001295356.1.85247 WP_001295356.1.85252 WP_001295356.1.85253 WP_001295356.1.85255 WP_001295356.1.85260 WP_001295356.1.8530 WP_001295356.1.85305 WP_001295356.1.85310 WP_001295356.1.85315 WP_001295356.1.85320 WP_001295356.1.85323 WP_001295356.1.85329 WP_001295356.1.85335 WP_001295356.1.85336 WP_001295356.1.85342 WP_001295356.1.85361 WP_001295356.1.85369 WP_001295356.1.85384 WP_001295356.1.85385 WP_001295356.1.85416 WP_001295356.1.85435 WP_001295356.1.85500 WP_001295356.1.85504 WP_001295356.1.85525 WP_001295356.1.85546 WP_001295356.1.85554 WP_001295356.1.85556 WP_001295356.1.85558 WP_001295356.1.85563 WP_001295356.1.85578 WP_001295356.1.85593 WP_001295356.1.8560 WP_001295356.1.85601 WP_001295356.1.85621 WP_001295356.1.85623 WP_001295356.1.8564 WP_001295356.1.85657 WP_001295356.1.85685 WP_001295356.1.85722 WP_001295356.1.85762 WP_001295356.1.85767 WP_001295356.1.85772 WP_001295356.1.85773 WP_001295356.1.8579 WP_001295356.1.85793 WP_001295356.1.85800 WP_001295356.1.85806 WP_001295356.1.8582 WP_001295356.1.85857 WP_001295356.1.85895 WP_001295356.1.8592 WP_001295356.1.85939 WP_001295356.1.85944 WP_001295356.1.85948 WP_001295356.1.85969 WP_001295356.1.86 WP_001295356.1.86001 WP_001295356.1.86016 WP_001295356.1.8603 WP_001295356.1.86035 WP_001295356.1.86063 WP_001295356.1.86104 WP_001295356.1.86105 WP_001295356.1.86110 WP_001295356.1.86115 WP_001295356.1.86145 WP_001295356.1.86149 WP_001295356.1.86161 WP_001295356.1.86166 WP_001295356.1.86171 WP_001295356.1.86176 WP_001295356.1.86179 WP_001295356.1.86181 WP_001295356.1.86189 WP_001295356.1.86196 WP_001295356.1.8621 WP_001295356.1.86210 WP_001295356.1.86225 WP_001295356.1.86227 WP_001295356.1.86228 WP_001295356.1.86234 WP_001295356.1.86255 WP_001295356.1.86261 WP_001295356.1.86263 WP_001295356.1.86266 WP_001295356.1.86273 WP_001295356.1.86276 WP_001295356.1.86280 WP_001295356.1.86283 WP_001295356.1.86294 WP_001295356.1.86307 WP_001295356.1.86340 WP_001295356.1.8635 WP_001295356.1.86353 WP_001295356.1.86355 WP_001295356.1.86364 WP_001295356.1.86371 WP_001295356.1.86376 WP_001295356.1.86393 WP_001295356.1.86411 WP_001295356.1.86412 WP_001295356.1.86437 WP_001295356.1.86451 WP_001295356.1.86452 WP_001295356.1.86454 WP_001295356.1.86461 WP_001295356.1.86475 WP_001295356.1.86483 WP_001295356.1.86492 WP_001295356.1.86518 WP_001295356.1.8652 WP_001295356.1.8656 WP_001295356.1.86560 WP_001295356.1.86574 WP_001295356.1.86583 WP_001295356.1.86586 WP_001295356.1.86598 WP_001295356.1.86609 WP_001295356.1.86613 WP_001295356.1.86617 WP_001295356.1.86627 WP_001295356.1.86640 WP_001295356.1.86673 WP_001295356.1.86674 WP_001295356.1.86681 WP_001295356.1.86691 WP_001295356.1.86707 WP_001295356.1.86717 WP_001295356.1.86727 WP_001295356.1.86731 WP_001295356.1.86734 WP_001295356.1.86753 WP_001295356.1.86760 WP_001295356.1.86768 WP_001295356.1.86788 WP_001295356.1.8679 WP_001295356.1.86833 WP_001295356.1.86846 WP_001295356.1.86848 WP_001295356.1.8687 WP_001295356.1.86934 WP_001295356.1.86935 WP_001295356.1.86956 WP_001295356.1.86959 WP_001295356.1.86975 WP_001295356.1.86994 WP_001295356.1.86997 WP_001295356.1.87043 WP_001295356.1.8705 WP_001295356.1.87059 WP_001295356.1.87067 WP_001295356.1.87074 WP_001295356.1.87075 WP_001295356.1.87076 WP_001295356.1.87102 WP_001295356.1.87109 WP_001295356.1.8711 WP_001295356.1.87147 WP_001295356.1.87177 WP_001295356.1.87199 WP_001295356.1.87205 WP_001295356.1.87247 WP_001295356.1.87249 WP_001295356.1.87254 WP_001295356.1.87310 WP_001295356.1.87339 WP_001295356.1.87358 WP_001295356.1.87371 WP_001295356.1.87382 WP_001295356.1.87389 WP_001295356.1.87400 WP_001295356.1.87410 WP_001295356.1.87443 WP_001295356.1.87465 WP_001295356.1.87491 WP_001295356.1.87504 WP_001295356.1.87563 WP_001295356.1.87568 WP_001295356.1.87574 WP_001295356.1.87581 WP_001295356.1.87590 WP_001295356.1.87607 WP_001295356.1.87608 WP_001295356.1.87610 WP_001295356.1.87616 WP_001295356.1.87633 WP_001295356.1.87635 WP_001295356.1.87639 WP_001295356.1.87655 WP_001295356.1.87675 WP_001295356.1.87694 WP_001295356.1.87696 WP_001295356.1.8771 WP_001295356.1.87721 WP_001295356.1.87726 WP_001295356.1.87728 WP_001295356.1.87733 WP_001295356.1.87738 WP_001295356.1.87766 WP_001295356.1.8778 WP_001295356.1.87786 WP_001295356.1.87788 WP_001295356.1.87789 WP_001295356.1.87822 WP_001295356.1.87834 WP_001295356.1.87857 WP_001295356.1.87883 WP_001295356.1.87914 WP_001295356.1.87919 WP_001295356.1.87973 WP_001295356.1.87976 WP_001295356.1.87980 WP_001295356.1.87984 WP_001295356.1.87989 WP_001295356.1.87990 WP_001295356.1.880 WP_001295356.1.88017 WP_001295356.1.88020 WP_001295356.1.88066 WP_001295356.1.8807 WP_001295356.1.88082 WP_001295356.1.88088 WP_001295356.1.88110 WP_001295356.1.88119 WP_001295356.1.88147 WP_001295356.1.88149 WP_001295356.1.88155 WP_001295356.1.88189 WP_001295356.1.88197 WP_001295356.1.8822 WP_001295356.1.88234 WP_001295356.1.88238 WP_001295356.1.88252 WP_001295356.1.88260 WP_001295356.1.88263 WP_001295356.1.88285 WP_001295356.1.88301 WP_001295356.1.88304 WP_001295356.1.88336 WP_001295356.1.88352 WP_001295356.1.88376 WP_001295356.1.88379 WP_001295356.1.88384 WP_001295356.1.88413 WP_001295356.1.88427 WP_001295356.1.8843 WP_001295356.1.88434 WP_001295356.1.88438 WP_001295356.1.88462 WP_001295356.1.88467 WP_001295356.1.8848 WP_001295356.1.88499 WP_001295356.1.88505 WP_001295356.1.88524 WP_001295356.1.88527 WP_001295356.1.88528 WP_001295356.1.88535 WP_001295356.1.88539 WP_001295356.1.8854 WP_001295356.1.8855 WP_001295356.1.88557 WP_001295356.1.88562 WP_001295356.1.88577 WP_001295356.1.88598 WP_001295356.1.88603 WP_001295356.1.88607 WP_001295356.1.88631 WP_001295356.1.88646 WP_001295356.1.88667 WP_001295356.1.88678 WP_001295356.1.88685 WP_001295356.1.88686 WP_001295356.1.88709 WP_001295356.1.88710 WP_001295356.1.88711 WP_001295356.1.88717 WP_001295356.1.88720 WP_001295356.1.88729 WP_001295356.1.8873 WP_001295356.1.88732 WP_001295356.1.88735 WP_001295356.1.88752 WP_001295356.1.88757 WP_001295356.1.88759 WP_001295356.1.88767 WP_001295356.1.8879 WP_001295356.1.88793 WP_001295356.1.88803 WP_001295356.1.88826 WP_001295356.1.88834 WP_001295356.1.88864 WP_001295356.1.88880 WP_001295356.1.88883 WP_001295356.1.88891 WP_001295356.1.88941 WP_001295356.1.88950 WP_001295356.1.88953 WP_001295356.1.88961 WP_001295356.1.88997 WP_001295356.1.89018 WP_001295356.1.89043 WP_001295356.1.89050 WP_001295356.1.8906 WP_001295356.1.89067 WP_001295356.1.89069 WP_001295356.1.89090 WP_001295356.1.89097 WP_001295356.1.89099 WP_001295356.1.89111 WP_001295356.1.89150 WP_001295356.1.89163 WP_001295356.1.89165 WP_001295356.1.89183 WP_001295356.1.89197 WP_001295356.1.89203 WP_001295356.1.89214 WP_001295356.1.89217 WP_001295356.1.89255 WP_001295356.1.8928 WP_001295356.1.89285 WP_001295356.1.89305 WP_001295356.1.89312 WP_001295356.1.89322 WP_001295356.1.89334 WP_001295356.1.89335 WP_001295356.1.89351 WP_001295356.1.89379 WP_001295356.1.8938 WP_001295356.1.89385 WP_001295356.1.89396 WP_001295356.1.894 WP_001295356.1.89400 WP_001295356.1.89403 WP_001295356.1.89405 WP_001295356.1.89416 WP_001295356.1.89427 WP_001295356.1.89432 WP_001295356.1.8945 WP_001295356.1.89455 WP_001295356.1.89458 WP_001295356.1.89466 WP_001295356.1.89468 WP_001295356.1.89469 WP_001295356.1.89471 WP_001295356.1.89474 WP_001295356.1.89479 WP_001295356.1.89492 WP_001295356.1.89496 WP_001295356.1.89510 WP_001295356.1.89551 WP_001295356.1.89569 WP_001295356.1.89583 WP_001295356.1.89601 WP_001295356.1.89605 WP_001295356.1.89627 WP_001295356.1.89630 WP_001295356.1.89631 WP_001295356.1.89646 WP_001295356.1.89656 WP_001295356.1.89674 WP_001295356.1.89679 WP_001295356.1.89700 WP_001295356.1.89710 WP_001295356.1.89745 WP_001295356.1.89747 WP_001295356.1.89768 WP_001295356.1.89781 WP_001295356.1.89788 WP_001295356.1.89818 WP_001295356.1.89839 WP_001295356.1.89841 WP_001295356.1.8985 WP_001295356.1.89852 WP_001295356.1.89879 WP_001295356.1.89895 WP_001295356.1.89899 WP_001295356.1.89915 WP_001295356.1.89917 WP_001295356.1.89918 WP_001295356.1.89920 WP_001295356.1.89923 WP_001295356.1.89925 WP_001295356.1.89927 WP_001295356.1.89959 WP_001295356.1.89977 WP_001295356.1.89988 WP_001295356.1.89998 WP_001295356.1.90017 WP_001295356.1.90022 WP_001295356.1.90050 WP_001295356.1.90063 WP_001295356.1.90065 WP_001295356.1.90078 WP_001295356.1.9009 WP_001295356.1.9010 WP_001295356.1.90115 WP_001295356.1.90128 WP_001295356.1.90139 WP_001295356.1.90146 WP_001295356.1.90156 WP_001295356.1.90168 WP_001295356.1.90171 WP_001295356.1.90182 WP_001295356.1.902 WP_001295356.1.90205 WP_001295356.1.90219 WP_001295356.1.90249 WP_001295356.1.90256 WP_001295356.1.90257 WP_001295356.1.90266 WP_001295356.1.90270 WP_001295356.1.90314 WP_001295356.1.90315 WP_001295356.1.90332 WP_001295356.1.90342 WP_001295356.1.90346 WP_001295356.1.90349 WP_001295356.1.90357 WP_001295356.1.90358 WP_001295356.1.9036 WP_001295356.1.9037 WP_001295356.1.90389 WP_001295356.1.90405 WP_001295356.1.90435 WP_001295356.1.90436 WP_001295356.1.90441 WP_001295356.1.90449 WP_001295356.1.90467 WP_001295356.1.90511 WP_001295356.1.90520 WP_001295356.1.90525 WP_001295356.1.90536 WP_001295356.1.90542 WP_001295356.1.90547 WP_001295356.1.9059 WP_001295356.1.90591 WP_001295356.1.90602 WP_001295356.1.9061 WP_001295356.1.90626 WP_001295356.1.90690 WP_001295356.1.90703 WP_001295356.1.90706 WP_001295356.1.90758 WP_001295356.1.90775 WP_001295356.1.90799 WP_001295356.1.9081 WP_001295356.1.90813 WP_001295356.1.90822 WP_001295356.1.90828 WP_001295356.1.90834 WP_001295356.1.90837 WP_001295356.1.90839 WP_001295356.1.9084 WP_001295356.1.90842 WP_001295356.1.90844 WP_001295356.1.90848 WP_001295356.1.90856 WP_001295356.1.90864 WP_001295356.1.90865 WP_001295356.1.9087 WP_001295356.1.90873 WP_001295356.1.90890 WP_001295356.1.909 WP_001295356.1.90905 WP_001295356.1.90924 WP_001295356.1.90951 WP_001295356.1.90960 WP_001295356.1.90967 WP_001295356.1.90979 WP_001295356.1.9098 WP_001295356.1.90988 WP_001295356.1.90996 WP_001295356.1.90997 WP_001295356.1.91 WP_001295356.1.91007 WP_001295356.1.91010 WP_001295356.1.91018 WP_001295356.1.9104 WP_001295356.1.91072 WP_001295356.1.91088 WP_001295356.1.91094 WP_001295356.1.91113 WP_001295356.1.91117 WP_001295356.1.91121 WP_001295356.1.91138 WP_001295356.1.91143 WP_001295356.1.91153 WP_001295356.1.91170 WP_001295356.1.9118 WP_001295356.1.91182 WP_001295356.1.9119 WP_001295356.1.91213 WP_001295356.1.91220 WP_001295356.1.91266 WP_001295356.1.91268 WP_001295356.1.91277 WP_001295356.1.91288 WP_001295356.1.91290 WP_001295356.1.91340 WP_001295356.1.91341 WP_001295356.1.91354 WP_001295356.1.91356 WP_001295356.1.91361 WP_001295356.1.91377 WP_001295356.1.91384 WP_001295356.1.91397 WP_001295356.1.91414 WP_001295356.1.91425 WP_001295356.1.91445 WP_001295356.1.91462 WP_001295356.1.91482 WP_001295356.1.91485 WP_001295356.1.91494 WP_001295356.1.915 WP_001295356.1.91511 WP_001295356.1.91515 WP_001295356.1.91516 WP_001295356.1.91526 WP_001295356.1.91543 WP_001295356.1.91548 WP_001295356.1.91549 WP_001295356.1.91551 WP_001295356.1.91565 WP_001295356.1.91566 WP_001295356.1.9157 WP_001295356.1.91594 WP_001295356.1.91596 WP_001295356.1.9160 WP_001295356.1.91626 WP_001295356.1.91630 WP_001295356.1.91640 WP_001295356.1.91643 WP_001295356.1.91644 WP_001295356.1.91651 WP_001295356.1.91666 WP_001295356.1.91672 WP_001295356.1.9168 WP_001295356.1.91685 WP_001295356.1.9169 WP_001295356.1.91701 WP_001295356.1.91739 WP_001295356.1.91756 WP_001295356.1.91777 WP_001295356.1.91779 WP_001295356.1.91787 WP_001295356.1.91793 WP_001295356.1.91801 WP_001295356.1.91814 WP_001295356.1.91843 WP_001295356.1.9185 WP_001295356.1.91850 WP_001295356.1.91863 WP_001295356.1.91871 WP_001295356.1.91879 WP_001295356.1.91887 WP_001295356.1.91893 WP_001295356.1.91894 WP_001295356.1.91951 WP_001295356.1.91954 WP_001295356.1.91959 WP_001295356.1.91965 WP_001295356.1.91971 WP_001295356.1.9199 WP_001295356.1.91994 WP_001295356.1.92005 WP_001295356.1.92014 WP_001295356.1.92019 WP_001295356.1.92025 WP_001295356.1.92029 WP_001295356.1.92031 WP_001295356.1.92048 WP_001295356.1.92053 WP_001295356.1.92058 WP_001295356.1.9209 WP_001295356.1.92096 WP_001295356.1.921 WP_001295356.1.92102 WP_001295356.1.92114 WP_001295356.1.92123 WP_001295356.1.9215 WP_001295356.1.92161 WP_001295356.1.92163 WP_001295356.1.92180 WP_001295356.1.92195 WP_001295356.1.92201 WP_001295356.1.92224 WP_001295356.1.92276 WP_001295356.1.92295 WP_001295356.1.92304 WP_001295356.1.92305 WP_001295356.1.92311 WP_001295356.1.92323 WP_001295356.1.92361 WP_001295356.1.92384 WP_001295356.1.924 WP_001295356.1.92403 WP_001295356.1.92434 WP_001295356.1.92462 WP_001295356.1.92473 WP_001295356.1.92495 WP_001295356.1.92496 WP_001295356.1.92506 WP_001295356.1.92532 WP_001295356.1.92535 WP_001295356.1.9255 WP_001295356.1.92568 WP_001295356.1.92571 WP_001295356.1.92577 WP_001295356.1.92614 WP_001295356.1.92615 WP_001295356.1.92634 WP_001295356.1.92638 WP_001295356.1.9264 WP_001295356.1.92648 WP_001295356.1.9266 WP_001295356.1.92668 WP_001295356.1.92693 WP_001295356.1.92708 WP_001295356.1.92719 WP_001295356.1.92742 WP_001295356.1.92750 WP_001295356.1.92767 WP_001295356.1.92780 WP_001295356.1.92781 WP_001295356.1.92792 WP_001295356.1.92793 WP_001295356.1.92796 WP_001295356.1.92819 WP_001295356.1.92845 WP_001295356.1.92865 WP_001295356.1.92882 WP_001295356.1.92886 WP_001295356.1.92932 WP_001295356.1.92943 WP_001295356.1.92953 WP_001295356.1.92991 WP_001295356.1.93016 WP_001295356.1.93017 WP_001295356.1.93019 WP_001295356.1.93023 WP_001295356.1.93027 WP_001295356.1.93033 WP_001295356.1.93048 WP_001295356.1.93052 WP_001295356.1.93054 WP_001295356.1.93069 WP_001295356.1.93072 WP_001295356.1.93085 WP_001295356.1.93100 WP_001295356.1.93112 WP_001295356.1.93138 WP_001295356.1.93139 WP_001295356.1.93150 WP_001295356.1.93167 WP_001295356.1.93175 WP_001295356.1.93185 WP_001295356.1.93233 WP_001295356.1.93252 WP_001295356.1.93267 WP_001295356.1.9327 WP_001295356.1.93276 WP_001295356.1.93291 WP_001295356.1.93309 WP_001295356.1.9331 WP_001295356.1.93312 WP_001295356.1.93326 WP_001295356.1.93338 WP_001295356.1.93379 WP_001295356.1.93388 WP_001295356.1.934 WP_001295356.1.93427 WP_001295356.1.93428 WP_001295356.1.93431 WP_001295356.1.93453 WP_001295356.1.93461 WP_001295356.1.93463 WP_001295356.1.93464 WP_001295356.1.93468 WP_001295356.1.93509 WP_001295356.1.93531 WP_001295356.1.93533 WP_001295356.1.93552 WP_001295356.1.9356 WP_001295356.1.93569 WP_001295356.1.93601 WP_001295356.1.93605 WP_001295356.1.93621 WP_001295356.1.93626 WP_001295356.1.93629 WP_001295356.1.93630 WP_001295356.1.93634 WP_001295356.1.93637 WP_001295356.1.93639 WP_001295356.1.93652 WP_001295356.1.93665 WP_001295356.1.93670 WP_001295356.1.93673 WP_001295356.1.93679 WP_001295356.1.93694 WP_001295356.1.93695 WP_001295356.1.93716 WP_001295356.1.93733 WP_001295356.1.93737 WP_001295356.1.93742 WP_001295356.1.93743 WP_001295356.1.93745 WP_001295356.1.93755 WP_001295356.1.93765 WP_001295356.1.93768 WP_001295356.1.938 WP_001295356.1.93800 WP_001295356.1.93821 WP_001295356.1.93873 WP_001295356.1.93877 WP_001295356.1.939 WP_001295356.1.93900 WP_001295356.1.93911 WP_001295356.1.93918 WP_001295356.1.93921 WP_001295356.1.93922 WP_001295356.1.93939 WP_001295356.1.93951 WP_001295356.1.93952 WP_001295356.1.93971 WP_001295356.1.94008 WP_001295356.1.94011 WP_001295356.1.94025 WP_001295356.1.94028 WP_001295356.1.94035 WP_001295356.1.94040 WP_001295356.1.94057 WP_001295356.1.94069 WP_001295356.1.94156 WP_001295356.1.9416 WP_001295356.1.94176 WP_001295356.1.94187 WP_001295356.1.94190 WP_001295356.1.9420 WP_001295356.1.94213 WP_001295356.1.94232 WP_001295356.1.9426 WP_001295356.1.94271 WP_001295356.1.94282 WP_001295356.1.94298 WP_001295356.1.94302 WP_001295356.1.94317 WP_001295356.1.94343 WP_001295356.1.94353 WP_001295356.1.94367 WP_001295356.1.94388 WP_001295356.1.94404 WP_001295356.1.94417 WP_001295356.1.94429 WP_001295356.1.94430 WP_001295356.1.94436 WP_001295356.1.94438 WP_001295356.1.94445 WP_001295356.1.94446 WP_001295356.1.94468 WP_001295356.1.94475 WP_001295356.1.94497 WP_001295356.1.94507 WP_001295356.1.94516 WP_001295356.1.94523 WP_001295356.1.94542 WP_001295356.1.94544 WP_001295356.1.94548 WP_001295356.1.9457 WP_001295356.1.94578 WP_001295356.1.94580 WP_001295356.1.94589 WP_001295356.1.94619 WP_001295356.1.94626 WP_001295356.1.94646 WP_001295356.1.94653 WP_001295356.1.94676 WP_001295356.1.94686 WP_001295356.1.94690 WP_001295356.1.94692 WP_001295356.1.94695 WP_001295356.1.94704 WP_001295356.1.94727 WP_001295356.1.94738 WP_001295356.1.94739 WP_001295356.1.9474 WP_001295356.1.94753 WP_001295356.1.94754 WP_001295356.1.94764 WP_001295356.1.94790 WP_001295356.1.948 WP_001295356.1.94801 WP_001295356.1.94806 WP_001295356.1.94808 WP_001295356.1.94822 WP_001295356.1.94823 WP_001295356.1.94836 WP_001295356.1.94841 WP_001295356.1.94847 WP_001295356.1.94869 WP_001295356.1.94877 WP_001295356.1.94880 WP_001295356.1.94889 WP_001295356.1.9489 WP_001295356.1.94892 WP_001295356.1.94898 WP_001295356.1.949 WP_001295356.1.94903 WP_001295356.1.94907 WP_001295356.1.9491 WP_001295356.1.94927 WP_001295356.1.94934 WP_001295356.1.94935 WP_001295356.1.94938 WP_001295356.1.94949 WP_001295356.1.94955 WP_001295356.1.94963 WP_001295356.1.94991 WP_001295356.1.94993 WP_001295356.1.94997 WP_001295356.1.95005 WP_001295356.1.95011 WP_001295356.1.95022 WP_001295356.1.95028 WP_001295356.1.95035 WP_001295356.1.95036 WP_001295356.1.95037 WP_001295356.1.95062 WP_001295356.1.95080 WP_001295356.1.95084 WP_001295356.1.95105 WP_001295356.1.95129 WP_001295356.1.9513 WP_001295356.1.95161 WP_001295356.1.95233 WP_001295356.1.95243 WP_001295356.1.95244 WP_001295356.1.95254 WP_001295356.1.95275 WP_001295356.1.95310 WP_001295356.1.95329 WP_001295356.1.95332 WP_001295356.1.95364 WP_001295356.1.95366 WP_001295356.1.95368 WP_001295356.1.95378 WP_001295356.1.95381 WP_001295356.1.95390 WP_001295356.1.95395 WP_001295356.1.95398 WP_001295356.1.95400 WP_001295356.1.95403 WP_001295356.1.95424 WP_001295356.1.95428 WP_001295356.1.95431 WP_001295356.1.95438 WP_001295356.1.95449 WP_001295356.1.95490 WP_001295356.1.95518 WP_001295356.1.95521 WP_001295356.1.95563 WP_001295356.1.9559 WP_001295356.1.95595 WP_001295356.1.95596 WP_001295356.1.95604 WP_001295356.1.95611 WP_001295356.1.95628 WP_001295356.1.95634 WP_001295356.1.95655 WP_001295356.1.9566 WP_001295356.1.95666 WP_001295356.1.95680 WP_001295356.1.95712 WP_001295356.1.95756 WP_001295356.1.95759 WP_001295356.1.95771 WP_001295356.1.95783 WP_001295356.1.95784 WP_001295356.1.95801 WP_001295356.1.95821 WP_001295356.1.95824 WP_001295356.1.95827 WP_001295356.1.95834 WP_001295356.1.95835 WP_001295356.1.95846 WP_001295356.1.95849 WP_001295356.1.95858 WP_001295356.1.95861 WP_001295356.1.95869 WP_001295356.1.95916 WP_001295356.1.95919 WP_001295356.1.95929 WP_001295356.1.95931 WP_001295356.1.95932 WP_001295356.1.95951 WP_001295356.1.960 WP_001295356.1.96015 WP_001295356.1.96032 WP_001295356.1.96053 WP_001295356.1.96059 WP_001295356.1.96066 WP_001295356.1.96086 WP_001295356.1.96097 WP_001295356.1.96110 WP_001295356.1.96114 WP_001295356.1.96128 WP_001295356.1.96143 WP_001295356.1.96145 WP_001295356.1.9616 WP_001295356.1.96177 WP_001295356.1.96215 WP_001295356.1.96222 WP_001295356.1.96223 WP_001295356.1.96229 WP_001295356.1.96247 WP_001295356.1.96253 WP_001295356.1.96263 WP_001295356.1.96278 WP_001295356.1.96279 WP_001295356.1.96281 WP_001295356.1.96290 WP_001295356.1.96293 WP_001295356.1.96299 WP_001295356.1.96303 WP_001295356.1.9631 WP_001295356.1.96339 WP_001295356.1.96341 WP_001295356.1.96378 WP_001295356.1.96392 WP_001295356.1.96394 WP_001295356.1.9641 WP_001295356.1.96417 WP_001295356.1.96420 WP_001295356.1.96425 WP_001295356.1.96450 WP_001295356.1.96457 WP_001295356.1.96478 WP_001295356.1.96479 WP_001295356.1.96480 WP_001295356.1.96484 WP_001295356.1.9649 WP_001295356.1.96494 WP_001295356.1.965 WP_001295356.1.96519 WP_001295356.1.96541 WP_001295356.1.96558 WP_001295356.1.96562 WP_001295356.1.9657 WP_001295356.1.96585 WP_001295356.1.96608 WP_001295356.1.96609 WP_001295356.1.9661 WP_001295356.1.96617 WP_001295356.1.96633 WP_001295356.1.96650 WP_001295356.1.96659 WP_001295356.1.96676 WP_001295356.1.9668 WP_001295356.1.96680 WP_001295356.1.96683 WP_001295356.1.96695 WP_001295356.1.96701 WP_001295356.1.9671 WP_001295356.1.96725 WP_001295356.1.96743 WP_001295356.1.96753 WP_001295356.1.96759 WP_001295356.1.96762 WP_001295356.1.96769 WP_001295356.1.96779 WP_001295356.1.96796 WP_001295356.1.96797 WP_001295356.1.96817 WP_001295356.1.9682 WP_001295356.1.96820 WP_001295356.1.96850 WP_001295356.1.96864 WP_001295356.1.96894 WP_001295356.1.9690 WP_001295356.1.96907 WP_001295356.1.96924 WP_001295356.1.96932 WP_001295356.1.96936 WP_001295356.1.96944 WP_001295356.1.96971 WP_001295356.1.96984 WP_001295356.1.96989 WP_001295356.1.97011 WP_001295356.1.97027 WP_001295356.1.97049 WP_001295356.1.97059 WP_001295356.1.9708 WP_001295356.1.97119 WP_001295356.1.97123 WP_001295356.1.97147 WP_001295356.1.97170 WP_001295356.1.97193 WP_001295356.1.97195 WP_001295356.1.97200 WP_001295356.1.97226 WP_001295356.1.9723 WP_001295356.1.97231 WP_001295356.1.97238 WP_001295356.1.97247 WP_001295356.1.97248 WP_001295356.1.97269 WP_001295356.1.97279 WP_001295356.1.97282 WP_001295356.1.9729 WP_001295356.1.97292 WP_001295356.1.97344 WP_001295356.1.97351 WP_001295356.1.97356 WP_001295356.1.97360 WP_001295356.1.97361 WP_001295356.1.97379 WP_001295356.1.97387 WP_001295356.1.9740 WP_001295356.1.97402 WP_001295356.1.97418 WP_001295356.1.97421 WP_001295356.1.97434 WP_001295356.1.97437 WP_001295356.1.97439 WP_001295356.1.97459 WP_001295356.1.97464 WP_001295356.1.9747 WP_001295356.1.97490 WP_001295356.1.97502 WP_001295356.1.97513 WP_001295356.1.97525 WP_001295356.1.97527 WP_001295356.1.97538 WP_001295356.1.97544 WP_001295356.1.97549 WP_001295356.1.97560 WP_001295356.1.97571 WP_001295356.1.97619 WP_001295356.1.97632 WP_001295356.1.97654 WP_001295356.1.97667 WP_001295356.1.97675 WP_001295356.1.97677 WP_001295356.1.97685 WP_001295356.1.9770 WP_001295356.1.97705 WP_001295356.1.97711 WP_001295356.1.97770 WP_001295356.1.97775 WP_001295356.1.97778 WP_001295356.1.97789 WP_001295356.1.97798 WP_001295356.1.978 WP_001295356.1.97802 WP_001295356.1.97815 WP_001295356.1.97822 WP_001295356.1.97823 WP_001295356.1.97825 WP_001295356.1.97871 WP_001295356.1.97890 WP_001295356.1.97895 WP_001295356.1.97919 WP_001295356.1.97930 WP_001295356.1.97932 WP_001295356.1.97962 WP_001295356.1.97982 WP_001295356.1.97996 WP_001295356.1.98000 WP_001295356.1.98005 WP_001295356.1.98012 WP_001295356.1.98026 WP_001295356.1.9803 WP_001295356.1.98046 WP_001295356.1.98082 WP_001295356.1.98083 WP_001295356.1.981 WP_001295356.1.98102 WP_001295356.1.98139 WP_001295356.1.98155 WP_001295356.1.9816 WP_001295356.1.98167 WP_001295356.1.9817 WP_001295356.1.98176 WP_001295356.1.98187 WP_001295356.1.98202 WP_001295356.1.98205 WP_001295356.1.98208 WP_001295356.1.98220 WP_001295356.1.98232 WP_001295356.1.98235 WP_001295356.1.98239 WP_001295356.1.98241 WP_001295356.1.98244 WP_001295356.1.98279 WP_001295356.1.98284 WP_001295356.1.98292 WP_001295356.1.98294 WP_001295356.1.98301 WP_001295356.1.98312 WP_001295356.1.98323 WP_001295356.1.98355 WP_001295356.1.98357 WP_001295356.1.98384 WP_001295356.1.98400 WP_001295356.1.98404 WP_001295356.1.98424 WP_001295356.1.98429 WP_001295356.1.9844 WP_001295356.1.98442 WP_001295356.1.98451 WP_001295356.1.98466 WP_001295356.1.98477 WP_001295356.1.98480 WP_001295356.1.98484 WP_001295356.1.98498 WP_001295356.1.98543 WP_001295356.1.98549 WP_001295356.1.98569 WP_001295356.1.98578 WP_001295356.1.9858 WP_001295356.1.98587 WP_001295356.1.98603 WP_001295356.1.98614 WP_001295356.1.98626 WP_001295356.1.98628 WP_001295356.1.98633 WP_001295356.1.9864 WP_001295356.1.98641 WP_001295356.1.98654 WP_001295356.1.98665 WP_001295356.1.98668 WP_001295356.1.98683 WP_001295356.1.98702 WP_001295356.1.98727 WP_001295356.1.98757 WP_001295356.1.98775 WP_001295356.1.98776 WP_001295356.1.98784 WP_001295356.1.98795 WP_001295356.1.9883 WP_001295356.1.98849 WP_001295356.1.98875 WP_001295356.1.98886 WP_001295356.1.98908 WP_001295356.1.98920 WP_001295356.1.98976 WP_001295356.1.98988 WP_001295356.1.99006 WP_001295356.1.99029 WP_001295356.1.99046 WP_001295356.1.99053 WP_001295356.1.99060 WP_001295356.1.9907 WP_001295356.1.99101 WP_001295356.1.99110 WP_001295356.1.99119 WP_001295356.1.99168 WP_001295356.1.99182 WP_001295356.1.99209 WP_001295356.1.99234 WP_001295356.1.99246 WP_001295356.1.99265 WP_001295356.1.99289 WP_001295356.1.99292 WP_001295356.1.99295 WP_001295356.1.9930 WP_001295356.1.99302 WP_001295356.1.99304 WP_001295356.1.99306 WP_001295356.1.99307 WP_001295356.1.99310 WP_001295356.1.99319 WP_001295356.1.99334 WP_001295356.1.99345 WP_001295356.1.99349 WP_001295356.1.9935 WP_001295356.1.99361 WP_001295356.1.99366 WP_001295356.1.99392 WP_001295356.1.9940 WP_001295356.1.99400 WP_001295356.1.99401 WP_001295356.1.99427 WP_001295356.1.99446 WP_001295356.1.99453 WP_001295356.1.99458 WP_001295356.1.99471 WP_001295356.1.99472 WP_001295356.1.99475 WP_001295356.1.99486 WP_001295356.1.99487 WP_001295356.1.99498 WP_001295356.1.9950 WP_001295356.1.99501 WP_001295356.1.99511 WP_001295356.1.99534 WP_001295356.1.99549 WP_001295356.1.99562 WP_001295356.1.99571 WP_001295356.1.99592 WP_001295356.1.99602 WP_001295356.1.99603 WP_001295356.1.99619 WP_001295356.1.99641 WP_001295356.1.99666 WP_001295356.1.99692 WP_001295356.1.99694 WP_001295356.1.99698 WP_001295356.1.99734 WP_001295356.1.99774 WP_001295356.1.99782 WP_001295356.1.99791 WP_001295356.1.99804 WP_001295356.1.99827 WP_001295356.1.99869 WP_001295356.1.99874 WP_001295356.1.99891 WP_001295356.1.99892 WP_001295356.1.99912 WP_001295356.1.99929 WP_001295356.1.99986 YP_002408142.1.10275 YP_002411909.1.14968 YP_006119240.1.29421 YP_006779976.1.12065 gi|170080624|ref|YP_001729944.1| gi|187733213|ref|YP_001880835.1| gi|260843215|ref|YP_003220993.1| gi|556551093|ref|YP_008721108.1| gi|386618563|ref|YP_006138143.1| gi|260854258|ref|YP_003228149.1| gi|407468442|ref|YP_006785116.1| gi|386708778|ref|YP_006172499.1| gi|254792166|ref|YP_003077003.1| gi|471333020|ref|YP_007556497.1| gi|218700513|ref|YP_002408142.1| gi|218553553|ref|YP_002386466.1| gi|218557865|ref|YP_002390778.1| gi|387620693|ref|YP_006128320.1| gi|383177616|ref|YP_005455621.1| cath|current|1vbvA00/3-97 gi|238900224|ref|YP_002926020.1| gi|544575360|ref|YP_008570884.1| gi|386623372|ref|YP_006143100.1| gi|170020633|ref|YP_001725587.1| gi|157160487|ref|YP_001457805.1| gi|260867137|ref|YP_003233539.1| gi|209398008|ref|YP_002269635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]