SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189184861|ref|YP_001938646.1| from Orientia tsutsugamushi str. Ikeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189184861|ref|YP_001938646.1|
Domain Number 1 Region: 129-258
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 3.31e-39
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.00000641
Further Details:      
 
Domain Number 2 Region: 28-128
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.51e-29
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|189184861|ref|YP_001938646.1|
Sequence length 261
Comment succinate dehydrogenase iron-sulfur subunit [Orientia tsutsugamushi str. Ikeda]
Sequence
MVEFRLPPNSKVKVGKRYAAKDSVKKVKRVSVYRYSPDTGDNPRIDIFEIDMENCGPMVL
DALIKIKNEIDPTLTFRRSCREGICGSCSMNINGTNGLACIKAINDIKGDVIIYPLPHMS
VIKDLVSDMTHFYAQYQSIEPWLKAETIDITSGERLQTPEDRDKLDGLYECILCACCSTA
CPSYWWNADKYLGPAVLLQAYRWIIDSRDEHTSERLDQLEDSFKLYRCHTIMNCTKTCPK
GLNPAKAISEIKKKMFERHGV
Download sequence
Identical sequences A0A0F3ME23 B3CVL5
WP_012462330.1.52205 WP_012462330.1.76158 WP_012462330.1.82250 gi|189184861|ref|YP_001938646.1| 334380.OTT_1954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]