SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|430745661|ref|YP_007204790.1| from Singulisphaera acidiphila DSM 18658

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|430745661|ref|YP_007204790.1|
Domain Number 1 Region: 13-54,84-149,196-301,451-490,536-571
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.28e-18
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Domain Number 2 Region: 398-619
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000000149
Family YVTN repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|430745661|ref|YP_007204790.1|
Sequence length 655
Comment hypothetical protein Sinac_4939 [Singulisphaera acidiphila DSM 18658]
Sequence
MPEITGRQQTRIDPSPAWTVHTEAPLKGMALAREAGTILAWDERGQLYLLDLLGNHRSVS
RAPDRVVAGTISDNGAFIALLGEGSRLWFLGADLDLIADRPAPPDATNLAVDPHGRYLAV
GSRLSMIQFYNRHGKQAGRLETRHAMAHLVFVPDRPFLLGAATYGMLVGIELEPGSSAGK
LAAEVAWEESLMSNVGRLTTTGDGGMILASCFTYGIQRFDFRGGNEGAYHLGGTAAHAVP
DFAGRMIAVSTLEGELAVLSSSGGVRWKTMLSRPVIALEADPLGRYLIHGHATGEIVRLD
LYGSSRPTMPRTSPEPATATPRPGASPMRTPAWSIPIASTDEQAESAVLTVLDDPARIGL
MTNSNRLQIFSSQGENLGQTPELLGFGRILRTAPGWIAAATDRYVMLYNARRSQAQRVDL
SMVEITHLAIAPDSYGLGVVQERDRIGRATLSGRWIWKRELASSVEDFAISPDGFTAVTT
TDGRLDVFDPAGEPVGGVPGNPADPLFLIEAPEGSPSQVAWVTLARRAQVLRGHDRTGKI
NWESPVPWEGWQLHRLGAIAMVSAPDGRTLAFDGAGHLRGQSRASDVPHDVFGTDPQGQT
LRVSRQGVHLICSDLSGRVNWRAVADQPLGPVAIGRTGVAVLIGRSLAWFPSTKP
Download sequence
Identical sequences L0DJS2
WP_015248203.1.65975 WP_015248203.1.91224 gi|430745661|ref|YP_007204790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]