SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|430746452|ref|YP_007205581.1| from Singulisphaera acidiphila DSM 18658

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|430746452|ref|YP_007205581.1|
Domain Number 1 Region: 5-222
Classification Level Classification E-value
Superfamily CutC-like 4.97e-67
Family CutC-like 0.00000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|430746452|ref|YP_007205581.1|
Sequence length 226
Comment hypothetical protein Sinac_5756 [Singulisphaera acidiphila DSM 18658]
Sequence
MNVAVEICVQGIESALAAYAGGADRIELCEDLAVGGVTPSLGTVAVACRRLAIPVHVLIR
PRGGDFVYSEAEFEVMQHDVAMAKSLGAAGVVIGLLQPDHSLDQTRLVQLIAASHPMDVT
FHRAFDEMANPLEVVDELIGLGVDRILTSGGAVRAVDGLARLAELSRQTAGRIAIAAGGR
ITEADLSAFLQANLKGIHIGSAVCTGDRIDADKVRRIVEVVRAWYH
Download sequence
Identical sequences L0DMK4
gi|430746452|ref|YP_007205581.1| WP_015248983.1.65975 WP_015248983.1.91224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]