SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004298 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004298
Domain Number 1 Region: 195-269
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000563
Family Voltage-gated potassium channels 0.0068
Further Details:      
 
Domain Number 2 Region: 399-449
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000275
Family cAMP-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004298   Gene: ENSFCAG00000004654   Transcript: ENSFCAT00000004654
Sequence length 744
Comment pep:novel genescaffold:CAT:GeneScaffold_3431:103689:330178:-1 gene:ENSFCAG00000004654 transcript:ENSFCAT00000004654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FYWDLIMLIMMVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVG
ATCYAMFVGHATALIQSLDSSRRQYQEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICLLTKGRRTASVRADTYCRLY
SLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLQKFQKDLNTGVFNNQENEIL
KQIVKHDREMVQAIAPISYPQMTALNATSSTTTPTSRMRTQSPPVYTATSLSHSNLHSPS
PSTQTPQPSAILSPCSYTTAVCSPPVQSPLATRTFHYASPTASQLSLTQQQQQQQIQQPQ
PPQPPQQPPQPQTPGSSTPKNDVHRSTQALHNTSLSREVRPLSASQPSLPHEVSTLISRP
HPTVGESLASIPQPVTAVHGPLQGARSTVPQRVTLFRQMSSGAIPPNRGAPPAPPPPAAA
LPREASSVLTTDPEAEKPRFASNL
Download sequence
Identical sequences ENSFCAP00000004298 9685.ENSFCAP00000004298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]