SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007733 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007733
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 443-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 386-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.32e-24
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 555-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 246-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 499-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 624-676
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 349-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000314
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 212-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000162
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000007733
Domain Number - Region: 135-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00057
Family Classic zinc finger, C2H2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007733   Gene: ENSFCAG00000008342   Transcript: ENSFCAT00000008342
Sequence length 694
Comment pep:novel genescaffold:CAT:GeneScaffold_4103:611488:617685:-1 gene:ENSFCAG00000008342 transcript:ENSFCAT00000008342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMSLGPVSFRDVAVDFTQEEWQYLDPEQKTTYRDVMLENYSHLVSVGCHIIKPEVIIKLE
QGEEPWIVEGEFLPHSYPEEVWKADDLVERVQENEGKHSRQAVSINKTPTEERGNVLGKT
LNVETNPIPSRKISYKCGSCEKSLKSISEYISSDGSYARRKPDECGACGKPFPRVKLEKT
HPGDQSYEFNQSGGAYSLNQESIYQNIHILGKPFEYIECQKAFQKDPGFANHMEEKPYKW
NESEIAFLQMSNLSVHQRSHMEMKPYECSACGKSFCKKSKFIIHQRTHTGEKPYECNQCG
KSFCQKGTLTVHQRTHTGEKPYECNECGKTFYQKLHLIQHQRTHSGEKPYECSYCGKSFC
QKTHLTQHQRTHSGERPYVCHDCGKTFSQKSALNDHQKIHTGVKLYKCNECGKCFCRKST
LTTHQRTHTGEKPYECNECGKFFSRLSYLTVHYRTHSGEKPYECNECGKTFYLNSALMRH
QRVHTGEKPYECNECGKLFSQLSYLTIHHRTHSGVKPYECNECGKTFYQNSALCRHRRIH
KGEKPYECYICGKFFSQMSYLTIHHRIHSGEKPYECNECGKTFCQNSALNRHQRTHTGEK
AYECYECGKFFSQMSYLTIHHRIHSGEKPFECNECGKAFSRMSYLTVHYRTHSGEKPYEC
NECGKKFYHKSAFNSHQRIHRRGSVNVLDVGRLL
Download sequence
Identical sequences 9685.ENSFCAP00000007733 ENSFCAP00000007733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]