SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008867 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008867
Domain Number 1 Region: 607-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 382-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 551-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 719-775
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 663-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.07e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 496-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.65e-20
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 7 Region: 764-816
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 29-76
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.15e-18
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 9 Region: 345-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-18
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 10 Region: 424-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000187
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008867   Gene: ENSFCAG00000009559   Transcript: ENSFCAT00000009561
Sequence length 824
Comment pep:novel genescaffold:CAT:GeneScaffold_4355:33435:47887:-1 gene:ENSFCAG00000009559 transcript:ENSFCAT00000009561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLTSRPRERALRSQVSALSQDGEDRTFQEPLTFKDVAVVFTEEELRLLDPTQRKLYRD
VMLENFQNLLSLGKRNLGDKNEKDLEYIQERELKCLSYRELSYWKIGEQAAAELTGSQDR
RVNLQGKDFQFSEDASPCQGWEGASPRGSQIDNLAGGLQGPISSENQAFPPWKAIRPVSV
QESWMKAFVNESWNVLERCKKLDTQGTTYKPEWDGFGFRWVSRCHDDHRLPERERPCDRE
RCGRDGLKKSTLRHPAPEEDDLRSSERGDGLRGASHLPAQPRAPWKEKARRCPEGGTGLR
QTAHLERPQRTPTDEKPSRGKERARGLRQNVCGPSRPRAPAGEMPYRCDVCGKGFRYQSI
LLIHQGVHTGKKPYACEECGKAFGRSSNLLVHQRVHTGEKPYKCGECGKGFSYSSVLQVH
RRLHTGEKPYACGECGKGFYAKSALHKHRHVHPGEKPFGCGAECGKGFSCGSHPSSHRKA
LAGQKPYRCDQCDKGFSYNSYLRAHQRVHTGQRLFDCDVCGKSFSYSSGLLRHQRLHTGE
KPYKCECGKGFGRSSDLHVHQRVHTGEKPYKCGECGKGFRRNSDLHSHQRVHTGERPFVC
DACGKGFIYSSDLLIHQRTHTGEKPYKCAECGKGFSYSSGLLIHQRVHTGEKPYKCEACG
KGFRCTSSLYKHQRIHTGKKPYTCDQCGKGFSYGSNLRTHQRLHTGEKPYTCYECGKGFR
YGSGLLSHKRVHTGEKPYRCDVCGKGYSQSSHLQGHQRVHTGEKPYRCEECGKGFGRSSC
LHVHQRVHTGEKPYKCGECGKGFSYSSGLRNHQRAHAGEKPEKQ
Download sequence
Identical sequences ENSFCAP00000008867 9685.ENSFCAP00000008867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]