SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189909987|ref|YP_001961542.1| from Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189909987|ref|YP_001961542.1|
Domain Number 1 Region: 462-482,521-770
Classification Level Classification E-value
Superfamily HAD-like 1.15e-52
Family Meta-cation ATPase, catalytic domain P 0.00041
Further Details:      
 
Domain Number 2 Region: 265-362
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.03e-25
Family Calcium ATPase, transduction domain A 0.0041
Further Details:      
 
Domain Number 3 Region: 228-265,363-457
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000994
Family Calcium ATPase, transmembrane domain M 0.0094
Further Details:      
 
Weak hits

Sequence:  gi|189909987|ref|YP_001961542.1|
Domain Number - Region: 25-66
Classification Level Classification E-value
Superfamily Ferritin-like 0.000892
Family Ribonucleotide reductase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|189909987|ref|YP_001961542.1|
Sequence length 777
Comment cation transport ATPase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)']
Sequence
MDMHAHHHHGSHPPAEPASPKDLKDPVCGMTVTEQSEHKLTHEGLPYYFCSAKCQGKFAA
NPLQYLVSTAPEDTAPEPAGTIYTCPMHPEVRQDHPGICPKCGMTLEPIIPLDEEDNHEL
KDFQHRFWWTLPFTVIVTVLAMFGHRLGWFDMNVQTWVELALSLPVVLWTGWPFFERGWQ
SLVHRSPNMWTLIGLGTGAAFLYSLVATVAPGVFPDSFISMGRVAVYYEAAVVIISLTML
GQIIELKARSQTSAAIKALLGLAPKTARRINADGSEEDVPLNHVHVGDLLRIRPGEKVPV
DGVVTEGSSAVDESMLTGEPVPVTKRLGDNVIGATMNTSGALVMRSEKVGAATMLSQIVQ
MVANAQRSKAPMQRMADVVAGKFVVVVVLIAIATFFVWGWFGPEPSWVFGLINAVAVLII
ACPCALGLATPMSVMVATGRAATQGVLFRDAGAIEKMREVDTLIVDKTGTLTEGKPAFDT
AVAAPGYTADEVLRLAASLDQGSEHPLAEAIVSAARAKGLELIKPLDFESGSGIGVRGIV
DGKHLVLGNTALMQQEGVATDALKVDGERLRSEGASVMHLAVDRQLAGILAVTDPIKATT
LEAIKTLHASGLRIVMATGDGLTTAKAVSAKLGIDEVHGEVKPADKLALVERLQKEGHIV
AMAGDGINDAPALAKADVGVAMGTGTDVAMNSGQITLVKGDLRGITAARDISIDTVRNMR
QNLLFAFVYNGIGVPIAAGVLYPFTGWLLSPLIAALAMSLSSASVIFNALRLRRGKK
Download sequence
Identical sequences WP_012476119.1.33202 WP_012476119.1.95533 355278.LBF_0420 gi|189909987|ref|YP_001961542.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]