SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327398859|ref|YP_004339728.1| from Hippea maritima DSM 10411

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327398859|ref|YP_004339728.1|
Domain Number 1 Region: 324-472
Classification Level Classification E-value
Superfamily Nucleotide cyclase 4.94e-48
Family GGDEF domain 0.0000509
Further Details:      
 
Domain Number 2 Region: 194-316,445-469
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000167
Family FCH domain 0.077
Further Details:      
 
Weak hits

Sequence:  gi|327398859|ref|YP_004339728.1|
Domain Number - Region: 63-174,216-267
Classification Level Classification E-value
Superfamily ARM repeat 0.00345
Family MIF4G domain-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|327398859|ref|YP_004339728.1|
Sequence length 481
Comment diguanylate cyclase [Hippea maritima DSM 10411]
Sequence
MLRKPKSGKTHCSVYIENLSTAIIHLLIALKANDEAIDSQIDKFKEQVKKIKFEENPSKV
IALRDSIADFVIKYDEYIHQKRDEFNKLLLSNISILITLAKSSEADTRWKNSLDEVKELL
KNKIDIEQLKKTKDILFKLGTATKDSKDIVYRDIVNILFELLDLETDSPDAKPYLEKVQK
LQTKLSSSPYRLDEKEIRDEIKSIVEEKERLEEEYIESLQKKLDKALKALIYTITTFTTS
SNNYVNTFEGHIEEINNTIKNGNVDVDELSKRLIGIAIKIKDTTLNMKNELEEYSKKIDE
AKKTIEELKEKLKKAEENLIIDPLTGVYNRRGLLHFLKIEIARAKRYKQPMSIIMADLDH
FSRVNNTYGHLAGDIVLKGFCKTVKSLIRATDIAARYGGEEFIIILPNTDIDSAYEVAEK
IRNAISKLKFKYKDETFSITSSFGVSQYKDDETIEKLIKRADAALYKAKEKRNITVKESQ
I
Download sequence
Identical sequences F2LV85
WP_013681710.1.98252 gi|327398859|ref|YP_004339728.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]