SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327399155|ref|YP_004340024.1| from Hippea maritima DSM 10411

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|327399155|ref|YP_004340024.1|
Domain Number - Region: 41-111
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0607
Family FCH domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|327399155|ref|YP_004340024.1|
Sequence length 138
Comment H+transporting two-sector ATPase subunit B/B' [Hippea maritima DSM 10411]
Sequence
MINIDSTLFAQMVAFGIVLVLLNFLLYKPLLSKIKERLSTIDELEKTAEHLKQEAQKNEQ
EYSLRLQEAEKQAKESYNSSVNVALKEKEEKVAEESKKAFEEIGKFEYEVKKEIEIELAS
SKDYSIELSNKIYKQLVG
Download sequence
Identical sequences F2LW31
gi|327399155|ref|YP_004340024.1| WP_013682004.1.98252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]