SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433637157|ref|YP_007282917.1| from Halovivax ruber XH-70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433637157|ref|YP_007282917.1|
Domain Number 1 Region: 16-93
Classification Level Classification E-value
Superfamily gp5 N-terminal domain-like 1.44e-22
Family gp4 N-terminal domain-like 0.0037
Further Details:      
 
Domain Number 2 Region: 83-224
Classification Level Classification E-value
Superfamily Phage fibre proteins 0.000000447
Family Tail-associated lysozyme gp5, C-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|433637157|ref|YP_007282917.1|
Sequence length 246
Comment hypothetical protein Halru_0132 [Halovivax ruber XH-70]
Sequence
MTRAGVFDGETSDGGIQGVVVGIVTDNEDPKDLGRVKLKFPWRDADDESYWARIATTMTG
DGYGSYFLPEVDDEVLVAFENGDIHTPFVVGSLWNGKQKPPQTNTEGKNEVREIRSRSDH
AITFDDADEGSITIETSGGHEIRIDDSSGSETISISDETGDNAITLDSSGGSVSIEAAKE
LDLKAPTITVNGKKKLKLSGGTAVDVSSKNKVSLSSNAQVAISSSGLMKIDSTGPMTLKG
ALIQLN
Download sequence
Identical sequences L0I7Y0
gi|433637157|ref|YP_007282917.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]