SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433637209|ref|YP_007282969.1| from Halovivax ruber XH-70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433637209|ref|YP_007282969.1|
Domain Number 1 Region: 34-132,180-388
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 4.92e-97
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000358
Further Details:      
 
Domain Number 2 Region: 472-648
Classification Level Classification E-value
Superfamily RuvA domain 2-like 3.61e-48
Family NAD+-dependent DNA ligase, domain 3 0.0000871
Further Details:      
 
Domain Number 3 Region: 390-466
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.28e-24
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00071
Further Details:      
 
Domain Number 4 Region: 660-736
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000224
Family DNA ligase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|433637209|ref|YP_007282969.1|
Sequence length 743
Comment DNA ligase, NAD-dependent [Halovivax ruber XH-70]
Sequence
MSADDEPLAADGENPYLREPPTDFRPVADIEESEADRQIELLREAIREHDRRYYVEGDPA
IADRTYDALFSRLEVLEDHFDRSAPDSPTNRVGGEPVDAFETVEHVSPMLSIDASGEVDD
VREYDQRVRRELGVGSTTDTAADDGTSDIGAVDSAGADDGTATLSDFSDTAAAGSTDVDA
DLGYVCEPKFDGVSIEFVYEDGRLVRAVTRGDGQEGDDVTKNARTIRTVPQRLRGDYPDF
LAVRGEVYMPKDAFQEHNRERIEQGKEPFANPRNATAGTIRQLDPSIVAERPLSVFFFEV
LDSSDGIERHTEALERFPDWGFRVTEEVERVESIDAAIDYRDDLLDRRDDLTFEIDGVVI
KVDEYASREALGTTARHDRWAYAYKFPARAEVTTIQDVAVQVGRTGRATPVALLDPVDVG
GVTVSRASLHNPSEIAEKNVNVGDTVRVQRAGDVIPYVAEVVEKGSDGHWELPDTCPVCE
SHLERDGPMAFCTGGLACDAQRRRSIEYYASDDGLDIEGLGEKSVRQLVAAGLLETVADL
YELDREDLVTLEGWGETSADNLLAELEDAREPPLPDFLSALGIQLVGPTTARELAREFET
FAAVREAAIDSPETLESVDEVGETVARAIHDFFTSEANAAVVEQLLEHVSPQAAAIEAGG
DELDGLTFVFTGALDAWTRGDAQDLVEAHGANATSSVSGNTDYLVAGENAGASKQTDAEE
NDVPVIDEAEFTELLVENGIEVA
Download sequence
Identical sequences L0I9D8
gi|433637209|ref|YP_007282969.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]