SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197335622|ref|YP_002155706.1| from Vibrio fischeri MJ11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197335622|ref|YP_002155706.1|
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 3.01e-54
Family Molybdopterin synthase subunit MoaE 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197335622|ref|YP_002155706.1|
Sequence length 148
Comment molybdopterin converting factor subunit 2 [Vibrio fischeri MJ11]
Sequence
MISVQEHDFNVGDEYQLLAEGTAAGAVVTFIGKVRDMNLGDDVTGLSLEHYPGMTEKSLN
DIVAQAKERWPLLKVKVIHRVGDLELGDQIVFVGVSSAHRGAAFDSCEFIMDYLKTNAPF
WKKERTTKEVRWVESRDTDKTAAERWEK
Download sequence
Identical sequences A0A1B9PCR5 B5FCP3 Q5E6A8
gi|59711550|ref|YP_204326.1| WP_005418591.1.100783 WP_005418591.1.198 WP_005418591.1.21686 WP_005418591.1.21775 WP_005418591.1.23113 WP_005418591.1.31530 WP_005418591.1.32349 WP_005418591.1.34024 WP_005418591.1.3463 WP_005418591.1.34959 WP_005418591.1.44395 WP_005418591.1.62330 WP_005418591.1.76599 WP_005418591.1.76652 WP_005418591.1.80135 WP_005418591.1.85856 WP_005418591.1.93430 WP_005418591.1.97281 YP_204326.1.56684 gi|197335622|ref|YP_002155706.1| 312309.VF_0943 388396.VFMJ11_0984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]