SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197337093|ref|YP_002158506.1| from Vibrio fischeri MJ11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197337093|ref|YP_002158506.1|
Domain Number 1 Region: 578-1046
Classification Level Classification E-value
Superfamily ALDH-like 4.97e-119
Family ALDH-like 0.000000911
Further Details:      
 
Domain Number 2 Region: 190-531
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2e-110
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000404
Further Details:      
 
Domain Number 3 Region: 17-189
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 8.5e-64
Family N-terminal domain of bifunctional PutA protein 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|197337093|ref|YP_002158506.1|
Sequence length 1049
Comment bifunctional protein PutA [Vibrio fischeri MJ11]
Sequence
MFQAKEVLSSSIIEQPLESLWSAISPLYMVDEAKWLHQLLPLARPTDREAVMMEKHAAIL
IQRVRDDKKAVQMIDALLLEYSLDTKEGILLMCLAEALMRIPDAETADALIRDKLSVADW
KSHLKNSDSTFVNASTWGLLLTGKVVSMDVKADGSPSNALSRLVNKFSEPVIRQAMNQAM
KIMGHQFVLGRTIEEAQKKGLSMREKGYTYSFDMLGEAALTQTDAHKYFKDYIMAIESVG
RAASIANSPEPTVSIKLSALHPRYEVANKERVMNEMYQSVLQLLERARELDVGITIDAEE
MDRLELSLELFEKLYRSDIVKGWGKFGLVVQAYSKRALPVLVWLTALSKEQGDLIPLRLV
KGAYWDTELKLSQQFGFARYPVFTRKEATDVSYLACARYLLSEHVKGKIFPQFASHNAHT
VAAIASMATHDEFEFQRLHGMGDALYEHAMDMFNRSVRIYAPVGSHKDLLPYLVRRLLEN
GANSSFVHRLVDANCPIESLTVHPVDSLLACPSLENQLIPLPPYIFSDRKNSYSINLDVE
SEAHPFEHQVKEQMKTYWQGGPIVNNIRDCESMIKEHGSALHVISSPYDRGNDVGSLVWS
SQEQVSNALDIAHDYFPIWQQTPVAERADYLEALADKLETNMPELVALCHKEAGKTIHDS
IDEVREAVDFCRYYAVQAKLNFTTAETIVGFDDISRQIERQGRGVFVCISPWNFPLAIFL
GQVTAALVAGNTVIAKPAEQTSLIAVRAIELLLETGIAPQAVHLLPGDGKTVGAPLTSDH
RVAGVAFTGSTETAQLINRTLANRSIEGEGGSPVPFIAETGGQNAMIVDSTALPEQVVRD
VMRSAFASAGQRCSALRVLFVQQDIADRIINLIKGAMAELSVGLPELHCTDVGPVIDVRA
KDKLMAHIERMTREGVLVAQADLPNWSEKGDFVPPSAFEIESIKQLENEQFGPILHIVRF
KASDIDKVISEINSTGFGLTMGIHSRNEVTYTRIEKNIKVGNCYINRDQVGAVVGVQPFG
GQGLSGTGPKAGGPRYLIRYTKANTTTSK
Download sequence
Identical sequences B5EUY8
388396.VFMJ11_A0958 gi|197337093|ref|YP_002158506.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]