SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326315061|ref|YP_004232733.1| from Acidovorax avenae subsp. avenae ATCC 19860

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326315061|ref|YP_004232733.1|
Domain Number 1 Region: 16-164,211-381
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 1.31e-78
Family Acetamidase/Formamidase-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|326315061|ref|YP_004232733.1|
Sequence length 408
Comment formamidase [Acidovorax avenae subsp. avenae ATCC 19860]
Sequence
MTDTLIKVDLTKSPTENENIHNRWHPDIPMACWVNPGDDFILETFDWTGGFIKNNDSADD
VRDIDLTTVHYLSGPVGVKGAEPGDLLVVDLLDIGAKPDSLWGFNGFFSKKNGGGFLTEH
FPEAQKSIWDFKGMFTSSRHIPGVNFAGLIHPGLIGCLPDRAMLDQWNAREQALIDSDPT
AGLANPPSPGTAHMGKMTGDARAKAAAEAARTVPPREHGGNCDIKDLSRGAKVYFPVYVD
GAGLSVGDLHFSQGDGEITFCGAIEMAGWVHMKVTLIKGGMAKYGIRNPIFKPSPIVPTY
NDYLIFEGISVDEAGKQYYLDVNVAYRQACLNAIEYLKKFGYSGAQAYSILGTAPVQGHI
SGVVDVPNACATLWLPTQIFDFDINPSASGPVKMLDGSIDMPLSPDLA
Download sequence
Identical sequences F0Q2Q7
WP_013592753.1.49867 gi|326315061|ref|YP_004232733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]